Clone RT01153 Report

Search the DGRC for RT01153

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:11
Well:53
Vector:pCR2.1
Associated Gene/Transcriptamos-RA
Protein status:RT01153.pep: gold
Sequenced Size:597

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10393 2006-05-19 RT target
amos 2008-04-29 Release 5.5 accounting
amos 2008-12-18 5.12 accounting

Clone Sequence Records

RT01153.complete Sequence

597 bp (597 high quality bases) assembled on 2008-11-04

GenBank Submission: BT028865.2

> RT01153.complete
ATGTTGACCAACAACGAGCTAATGGAGCAGTTCTACTTCCCCGACGAAGC
CCCAGCGATTCCCGAGTTCCTGAGCAACGACACCTTCCAGCAGTTGGAGC
AGCTCATGTACCAGCAGGAGTTCAGCACCAGCGACAGCCAGTCGGATGGC
GCCAACAGTTGCTCCTTGGAGATGTATTACGATACGCCGTCTGTCCTGGA
ATTGGAGCACATGCTGAATGCCCAGGAGCAGCAGCAGCACCACCTTCAAG
CGAATCCCTTGGGCAAGAATCAGGGCAGAAGTCCAAGGTACTGGAACAAG
CAGCAGAGGAGCAAGCCATACGACAAGCTGTCCACTTCCATGTCATCATC
TACATCCTCCGCCTCTTCGAGCAGTTCATCGTCCGCGGGATTCGGTGGCG
AAGTCCTCAAAAAACGGCGACTGGCCGCCAATGCTCGGGAACGGAGGCGG
ATGAACAGCCTGAACGATGCCTTCGACAAGTTGAGAGATGTGGTTCCATC
ACTCGGCCACGATCGGCGACTCTCCAAATACGAAACTCTGCAAATGGCGC
AAGCATACATCGGGGATCTGGTCACGTTGCTGTCCAGAGACTACTAG

RT01153.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
amos-RA 1154 amos-RA 295..891 1..597 2985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18595017..18595613 597..1 2970 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:41:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18596310..18596906 597..1 2985 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18596310..18596906 597..1 2985 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:19:10 has no hits.

RT01153.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:53 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18595017..18595613 1..597 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:53 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:02 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:40 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:15 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:12 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:59:41 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 295..891 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:01 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 295..891 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:40 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 16..612 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 17:36:52 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 295..891 1..597 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:12 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
amos-RA 16..612 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:53 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18596310..18596906 1..597 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:53 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18596310..18596906 1..597 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:53 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18596310..18596906 1..597 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:40 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18596310..18596906 1..597 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:18 Download gff for RT01153.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18596310..18596906 1..597 100   Minus

RT01153.pep Sequence

Translation from 0 to 596

> RT01153.pep
MLTNNELMEQFYFPDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDG
ANSCSLEMYYDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNK
QQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRR
MNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRDY*

RT01153.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14839-PA 199 GF14839-PA 1..199 1..198 699 73.5 Plus
Dana\GF18335-PA 310 GF18335-PA 250..309 135..194 213 70 Plus
Dana\GF11275-PA 200 GF11275-PA 87..170 115..194 206 54.8 Plus
Dana\GF16621-PA 195 GF16621-PA 50..144 98..195 171 40.8 Plus
Dana\GF14327-PA 407 GF14327-PA 158..213 139..194 162 55.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21703-PA 196 GG21703-PA 1..196 1..198 855 93.4 Plus
Dere\GG24254-PA 315 GG24254-PA 255..314 135..194 213 70 Plus
Dere\GG22282-PA 189 GG22282-PA 78..159 113..194 203 56.1 Plus
Dere\GG17199-PA 195 GG17199-PA 88..143 140..195 170 58.9 Plus
Dere\GG21298-PA 392 GG21298-PA 157..212 139..194 162 55.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10530-PA 214 GH10530-PA 1..214 1..198 515 58.1 Plus
Dgri\GH18671-PA 326 GH18671-PA 266..325 135..194 214 70 Plus
Dgri\GH19754-PA 189 GH19754-PA 104..163 135..194 205 66.7 Plus
Dgri\GH19315-PA 197 GH19315-PA 86..141 140..195 169 58.9 Plus
Dgri\GH13314-PA 421 GH13314-PA 118..201 111..194 161 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
amos-PA 198 CG10393-PA 1..198 1..198 1014 100 Plus
ato-PA 312 CG7508-PA 252..311 135..194 203 70 Plus
cato-PA 189 CG7760-PA 68..160 102..195 199 50 Plus
dimm-PB 390 CG8667-PB 129..212 111..194 173 44 Plus
dimm-PA 390 CG8667-PA 129..212 111..194 173 44 Plus
Fer3-PA 195 CG6913-PA 63..143 116..195 170 50.6 Plus
Fer2-PE 273 CG5952-PE 67..208 73..198 158 33.1 Plus
Fer2-PB 274 CG5952-PB 67..208 73..198 158 33.1 Plus
Fer2-PC 279 CG5952-PC 67..213 73..198 152 32 Plus
Fer1-PA 251 CG33323-PA 79..140 136..197 148 46.8 Plus
Fer1-PB 256 CG33323-PB 84..145 136..197 148 46.8 Plus
Fer2-PD 283 CG5952-PD 67..217 73..198 148 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17198-PA 217 GI17198-PA 1..217 1..198 543 59.7 Plus
Dmoj\GI24182-PA 330 GI24182-PA 243..329 117..194 215 54 Plus
Dmoj\GI20292-PA 196 GI20292-PA 98..168 124..194 204 59.2 Plus
Dmoj\GI23534-PA 187 GI23534-PA 39..134 98..195 171 40.8 Plus
Dmoj\GI23536-PA 199 GI23536-PA 89..144 140..195 169 58.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18743-PA 206 GL18743-PA 1..206 1..198 597 69.9 Plus
Dper\GL23421-PA 327 GL23421-PA 267..326 135..194 214 70 Plus
Dper\GL12254-PA 190 GL12254-PA 75..130 140..195 168 58.9 Plus
Dper\GL26661-PA 421 GL26661-PA 152..207 139..194 160 55.4 Plus
Dper\GL12422-PA 253 GL12422-PA 79..140 136..197 153 46.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10296-PA 206 GA10296-PA 1..206 1..198 593 69.4 Plus
Dpse\ato-PA 330 GA20401-PA 270..329 135..194 213 70 Plus
Dpse\GA20568-PA 197 GA20568-PA 106..165 135..194 205 66.7 Plus
Dpse\GA19952-PA 205 GA19952-PA 90..145 140..195 169 58.9 Plus
Dpse\GA21247-PA 421 GA21247-PA 152..207 139..194 160 55.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17083-PA 197 GM17083-PA 1..197 1..198 1007 97 Plus
Dsec\GM23715-PA 312 GM23715-PA 252..311 135..194 214 70 Plus
Dsec\GM20070-PA 188 GM20070-PA 77..158 113..194 203 54.9 Plus
Dsec\GM26078-PA 245 GM26078-PA 138..193 140..195 171 58.9 Plus
Dsec\GM10936-PA 247 GM10936-PA 79..140 136..197 153 46.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21828-PA 197 GD21828-PA 1..197 1..198 1019 98 Plus
Dsim\GD18530-PA 284 GD18530-PA 224..283 135..194 214 70 Plus
Dsim\GD25551-PA 188 GD25551-PA 77..158 113..194 203 54.9 Plus
Dsim\GD20641-PA 195 GD20641-PA 88..143 140..195 170 58.9 Plus
Dsim\GD24318-PA 386 GD24318-PA 155..210 139..194 161 55.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19805-PA 201 GJ19805-PA 1..201 1..198 525 61.7 Plus
Dvir\ato-PA 325 GJ10529-PA 265..324 135..194 214 70 Plus
Dvir\GJ22019-PA 197 GJ22019-PA 66..171 60..194 212 41.5 Plus
Dvir\GJ10284-PA 198 GJ10284-PA 88..143 140..195 169 58.9 Plus
Dvir\GJ17849-PA 418 GJ17849-PA 151..206 139..194 159 55.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24655-PA 198 GK24655-PA 1..198 1..198 623 64.6 Plus
Dwil\GK11390-PA 331 GK11390-PA 271..330 135..194 214 70 Plus
Dwil\GK20722-PA 168 GK20722-PA 81..141 135..195 208 67.2 Plus
Dwil\GK11993-PA 198 GK11993-PA 88..143 140..195 170 58.9 Plus
Dwil\GK18738-PA 392 GK18738-PA 154..209 139..194 160 55.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12726-PA 198 GE12726-PA 1..198 1..198 863 93 Plus
Dyak\GE25860-PA 313 GE25860-PA 253..312 135..194 214 70 Plus
Dyak\GE14078-PA 189 GE14078-PA 78..162 113..197 211 55.3 Plus
Dyak\GE10092-PA 226 GE10092-PA 119..174 140..195 170 58.9 Plus
Dyak\GE12913-PA 393 GE12913-PA 157..212 139..194 161 55.4 Plus

RT01153.hyp Sequence

Translation from 1 to 596

> RT01153.hyp
MLTNNELMEQFYFPDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDG
ANSCSLEMYYDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNK
QQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRR
MNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRDY*

RT01153.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
amos-PA 198 CG10393-PA 1..198 1..198 1014 100 Plus
ato-PA 312 CG7508-PA 252..311 135..194 203 70 Plus
cato-PA 189 CG7760-PA 68..160 102..195 199 50 Plus
dimm-PB 390 CG8667-PB 129..212 111..194 173 44 Plus
Fer3-PA 195 CG6913-PA 63..143 116..195 170 50.6 Plus