Clone RT01156 Report

Search the DGRC for RT01156

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:11
Well:56
Vector:pCR2.1
Associated Gene/Transcriptfd96Ca-RA
Protein status:RT01156.pep: gold
Sequenced Size:1119

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11921 2006-05-19 RT target
fd96Ca 2008-04-29 Release 5.5 accounting
fd96Ca 2008-08-15 Release 5.9 accounting
fd96Ca 2008-12-18 5.12 accounting

Clone Sequence Records

RT01156.complete Sequence

1119 bp (1119 high quality bases) assembled on 2010-06-22

GenBank Submission: BT029152.1

> RT01156.complete
ATGCCCCGGCCCTCGCGAGAATCCTACGGCGAACAGAAGCCCCCCTATTC
GTACATTTCGCTAACGGCCATGGCCATCTGGAGTTCGCCGGAGAAAATGT
TGCCGCTCAGCGATATCTACAAGTTTATCACGGACCGATTTCCGTACTAC
CGCAAGAACACCCAGCGCTGGCAAAATTCGCTGAGGCACAATCTCAGCTT
CAACGATTGCTTCATCAAGGTGCCCCGACGGCCGGATAGACCCGGCAAGG
GAGCCTACTGGGCACTGCATCCGCAGGCCTTTGATATGTTCGAAAACGGC
AGCCTGCTCCGGCGGAGGAAGCGCTTCAAGCTGCACAAGAACGACAAGGA
TCTGCTCAACGAGGAGCTGACTGCCCTGGCGAACCTCAATAGATTCTTCT
TTACCACCCGTAACGGAGGCAGTGCAGCGCACATGTCGCCGCTGGATATG
AACAATGCGGCCGCCATGAGACTGGATCCACTGCCCAGGAGCACGGCGCA
CATGCCAAACTCCCTGGGTCCAGGTGTGCCACTGCCGCACGTAATGCCCG
CCTCCATGTCCGGTGCGGATCACACGAATCTGGCGGACATGGGACTGACC
AATCTGCCCGCGCTAACCAGTTCCGAGATCGAGGGACCGCTGAGCCTGCG
ACCCAAGCGATCCTTCACGATAGAGAGCCTGATCACGCCCGACAAGCCGG
AACATCCGTCGGAGGACGAGGACGACGAGGATGACCGCGTCGATATCGAT
GTGGTCGAGTGCAGCGGTATCAGCCGCTATCCCACAACGCCCGCCGCCTC
CGAGGAGTATATGTCCGCCAGCCGATCGAGCCGAACGGAGGATCCCCTGC
CGCCGATGCACACGATCAACGCCGGTGCCCACGTGCCGTTTCTGCACTAT
GCCACGGGTGCCAATGTGGCCGGACTGCCAGCGTCGGGAATACCCAATAG
CCCCACCACCTACGAGCTGGCCATCTCGCATCCGCTCTTCATGATGGCGG
CGCCCATTGCCAACATGCACAACATATACTACAATAATGTTACCCTCGTC
GCTCCGGCGCAGCAATATCGGAGCCCCGAGGTGCAGAATAGAATAGACAA
CGATATGCGTACGATATAG

RT01156.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
fd96Ca-RA 1119 fd96Ca-RA 1..1119 1..1119 5595 100 Plus
fd96Cb-RA 825 fd96Cb-RA 94..233 85..224 280 80 Plus
croc-RA 2522 croc-RA 570..760 37..227 220 74.3 Plus
fd96Cb-RA 825 fd96Cb-RA 251..324 242..315 205 85.1 Plus
fd96Cb-RA 825 fd96Cb-RA 33..86 24..77 165 87 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20906709..20907827 1..1119 5535 99.6 Plus
chr3R 27901430 chr3R 20918294..20918585 24..315 455 77.1 Plus
chr3L 24539361 chr3L 21464673..21464936 300..37 225 72.3 Minus
chr2R 21145070 chr2R 18755742..18755886 185..329 215 76.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:41:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25083552..25084670 1..1119 5595 100 Plus
3R 32079331 3R 25095141..25095432 24..315 455 77.1 Plus
3L 28110227 3L 21475724..21475987 300..37 225 72.3 Minus
2R 25286936 2R 22869222..22869366 185..329 215 76.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24824383..24825501 1..1119 5595 100 Plus
3R 31820162 3R 24836033..24836172 85..224 280 80 Plus
3L 28103327 3L 21468897..21469087 227..37 220 74.3 Minus
2R 25260384 2R 22870421..22870565 185..329 215 76.5 Plus
3R 31820162 3R 24836190..24836263 242..315 205 85.1 Plus
3R 31820162 3R 24835972..24836025 24..77 165 87 Plus
Blast to na_te.dros performed on 2019-03-15 21:19:13 has no hits.

RT01156.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:55 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20906709..20907827 1..1119 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-22 15:08:57 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1119 1..1119 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:37:10 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1119 1..1119 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:41 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1119 1..1119 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:48:28 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1117 1..1117 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:15 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1119 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-22 15:08:56 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1119 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:37:10 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1119 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:41 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 376..1494 1..1119 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:48:27 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 1..1117 1..1117 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:15 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
fd96Ca-RA 376..1494 1..1119 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:55 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25083552..25084670 1..1119 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:55 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25083552..25084670 1..1119 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:55 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25083552..25084670 1..1119 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:41 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20909274..20910392 1..1119 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:51 Download gff for RT01156.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24824383..24825501 1..1119 100   Plus

RT01156.pep Sequence

Translation from 0 to 1118

> RT01156.pep
MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYY
RKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENG
SLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSAAHMSPLDM
NNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLT
NLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDID
VVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHY
ATGANVAGLPASGIPNSPTTYELAISHPLFMMAAPIANMHNIYYNNVTLV
APAQQYRSPEVQNRIDNDMRTI*

RT01156.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17887-PA 374 GF17887-PA 1..374 1..372 1611 86.2 Plus
Dana\GF17888-PA 272 GF17888-PA 1..211 1..239 571 52.7 Plus
Dana\GF16437-PA 491 GF16437-PA 180..293 2..115 433 63.2 Plus
Dana\GF13549-PA 456 GF13549-PA 78..175 13..110 358 66.3 Plus
Dana\GF23559-PA 508 GF23559-PA 70..179 13..126 347 56.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11359-PA 373 GG11359-PA 1..373 1..372 1931 96.8 Plus
Dere\GG11360-PA 265 GG11360-PA 2..198 8..238 520 49.4 Plus
Dere\GG12065-PA 511 GG12065-PA 200..313 2..115 432 63.2 Plus
Dere\GG22808-PA 454 GG22808-PA 85..182 13..110 357 66.3 Plus
Dere\GG13233-PA 507 GG13233-PA 70..179 13..126 346 56.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18035-PA 395 GH18035-PA 1..395 1..372 1167 62.8 Plus
Dgri\GH18036-PA 294 GH18036-PA 1..232 1..269 562 46.1 Plus
Dgri\GH18716-PA 492 GH18716-PA 177..290 2..115 432 63.2 Plus
Dgri\GH21797-PA 456 GH21797-PA 79..176 13..110 358 66.3 Plus
Dgri\GH15375-PA 508 GH15375-PA 70..179 13..126 347 56.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
fd96Ca-PB 372 CG11921-PB 1..372 1..372 1979 100 Plus
fd96Ca-PA 372 CG11921-PA 1..372 1..372 1979 100 Plus
fd96Cb-PA 271 CG11922-PA 1..204 1..238 552 49 Plus
fkh-PD 510 CG10002-PD 199..312 2..115 414 63.2 Plus
fkh-PB 510 CG10002-PB 199..312 2..115 414 63.2 Plus
fkh-PA 510 CG10002-PA 199..312 2..115 414 63.2 Plus
fkh-PE 518 CG10002-PE 199..312 2..115 414 63.2 Plus
fkh-PC 692 CG10002-PC 199..312 2..115 414 63.2 Plus
croc-PA 508 CG5069-PA 70..271 13..233 370 38 Plus
fd59A-PA 456 CG3668-PA 85..182 13..110 350 66.3 Plus
FoxL1-PB 365 CG1132-PB 86..196 8..112 333 57.7 Plus
FoxL1-PA 365 CG1132-PA 86..196 8..112 333 57.7 Plus
slp2-PA 451 CG2939-PA 170..363 3..183 311 41.8 Plus
slp1-PA 322 CG16738-PA 119..215 12..106 279 53.6 Plus
fd102C-PA 599 CG11152-PA 127..228 11..114 272 51 Plus
FoxK-PK 740 CG11799-PK 437..543 4..108 269 50.5 Plus
FoxK-PP 745 CG11799-PP 443..549 4..108 269 50.5 Plus
FoxK-PO 745 CG11799-PO 442..548 4..108 269 50.5 Plus
FoxK-PJ 746 CG11799-PJ 443..549 4..108 269 50.5 Plus
FoxK-PI 746 CG11799-PI 443..549 4..108 269 50.5 Plus
FoxK-PH 746 CG11799-PH 443..549 4..108 269 50.5 Plus
FoxK-PG 746 CG11799-PG 443..549 4..108 269 50.5 Plus
FoxK-PN 760 CG11799-PN 443..549 4..108 269 50.5 Plus
fd19B-PA 260 CG9571-PA 58..141 13..96 263 58.3 Plus
CHES-1-like-PC 1267 CG12690-PC 700..778 13..92 212 50 Plus
CHES-1-like-PD 1268 CG12690-PD 700..778 13..92 212 50 Plus
CHES-1-like-PB 1268 CG12690-PB 700..778 13..92 212 50 Plus
CHES-1-like-PA 1268 CG12690-PA 700..778 13..92 212 50 Plus
bin-PA 676 CG18647-PA 310..408 12..108 207 41.4 Plus
jumu-PA 719 CG4029-PA 411..498 13..98 188 42.7 Plus
FoxP-PD 442 CG43067-PD 318..399 5..89 178 40.2 Plus
fd3F-PC 744 CG44123-PC 396..473 8..89 175 45.1 Plus
FoxP-PC 520 CG43067-PC 318..417 5..107 164 34.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23781-PA 391 GI23781-PA 1..391 1..372 1208 62.8 Plus
Dmoj\GI23783-PA 286 GI23783-PA 1..199 1..231 492 47.9 Plus
Dmoj\GI22864-PA 501 GI22864-PA 187..300 2..115 432 63.2 Plus
Dmoj\GI20546-PA 481 GI20546-PA 94..191 13..110 361 66.3 Plus
Dmoj\GI12979-PA 505 GI12979-PA 70..179 13..126 348 56.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21898-PA 379 GL21898-PA 1..379 1..372 1443 76.6 Plus
Dper\GL21899-PA 260 GL21899-PA 1..192 1..231 500 46.4 Plus
Dper\GL23472-PA 586 GL23472-PA 170..283 2..115 433 63.2 Plus
Dper\GL10130-PA 457 GL10130-PA 73..170 13..110 359 66.3 Plus
Dper\GL15055-PA 423 GL15055-PA 70..179 13..126 346 56.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27944-PA 260 GA27944-PA 1..192 1..231 488 46.8 Plus
Dpse\GA10002-PB 481 GA10002-PB 170..283 2..115 431 63.2 Plus
Dpse\GA17601-PA 457 GA17601-PA 73..170 13..110 360 66.3 Plus
Dpse\GA18636-PA 523 GA18636-PA 70..179 13..126 346 56.1 Plus
Dpse\GA10915-PA 377 GA10915-PA 85..179 12..100 323 62.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17800-PA 372 GM17800-PA 1..372 1..372 1965 98.7 Plus
Dsec\GM17802-PA 265 GM17802-PA 2..198 8..238 529 48.7 Plus
Dsec\GM16286-PA 505 GM16286-PA 194..307 2..115 432 63.2 Plus
Dsec\GM15965-PA 456 GM15965-PA 85..182 13..110 358 66.3 Plus
Dsec\GM22139-PA 507 GM22139-PA 70..179 13..126 346 56.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11775-PA 228 GD11775-PA 1..228 145..372 1174 98.2 Plus
Dsim\GD21173-PA 265 GD21173-PA 2..198 8..238 515 47.9 Plus
Dsim\GD21172-PA 87 GD21172-PA 1..87 286..372 450 97.7 Plus
Dsim\GD18028-PA 510 GD18028-PA 199..312 2..115 432 63.2 Plus
Dsim\GD21171-PA 87 GD21171-PA 1..73 1..73 398 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23595-PA 392 GJ23595-PA 1..392 1..372 1152 62.2 Plus
Dvir\fkh-PA 502 GJ14162-PA 187..300 2..115 433 63.2 Plus
Dvir\GJ22399-PA 471 GJ22399-PA 85..182 13..110 358 66.3 Plus
Dvir\GJ13122-PA 508 GJ13122-PA 70..179 13..126 348 56.1 Plus
Dvir\GJ15456-PA 348 GJ15456-PA 84..179 12..101 322 60.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13404-PA 389 GK13404-PA 1..389 1..372 1343 71.2 Plus
Dwil\GK13405-PA 211 GK13405-PA 1..136 1..136 507 65.4 Plus
Dwil\GK10997-PA 652 GK10997-PA 168..281 2..115 435 63.2 Plus
Dwil\GK20787-PA 467 GK20787-PA 79..176 13..110 361 66.3 Plus
Dwil\GK16995-PA 528 GK16995-PA 70..179 13..126 346 56.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23556-PA 374 GE23556-PA 1..374 1..372 1930 97.3 Plus
Dyak\GE23557-PA 270 GE23557-PA 2..203 8..238 518 48.9 Plus
Dyak\GE10507-PA 509 GE10507-PA 198..311 2..115 432 63.2 Plus
Dyak\GE14241-PA 454 GE14241-PA 85..182 13..110 357 66.3 Plus
Dyak\GE22970-PA 507 GE22970-PA 70..179 13..126 346 56.1 Plus

RT01156.hyp Sequence

Translation from 1 to 1118

> RT01156.hyp
MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYY
RKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENG
SLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSAAHMSPLDM
NNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLT
NLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDID
VVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHY
ATGANVAGLPASGIPNSPTTYELAISHPLFMMAAPIANMHNIYYNNVTLV
APAQQYRSPEVQNRIDNDMRTI*

RT01156.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
fd96Ca-PB 372 CG11921-PB 1..372 1..372 1979 100 Plus
fd96Ca-PA 372 CG11921-PA 1..372 1..372 1979 100 Plus
fd96Cb-PA 271 CG11922-PA 1..204 1..238 552 49 Plus
fkh-PD 510 CG10002-PD 199..312 2..115 414 63.2 Plus
fkh-PB 510 CG10002-PB 199..312 2..115 414 63.2 Plus