Clone RT02902 Report

Search the DGRC for RT02902

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:2
Vector:pCR2.1
Associated Gene/TranscriptLcp65Aa-RA
Protein status:RT02902.pep: gold
Sequenced Size:327

Clone Sequence Records

RT02902.complete Sequence

327 bp assembled on 2010-02-26

GenBank Submission: BT099966.3

> RT02902.complete
ATGAAATCCATCCTTGTGCTCGCCTGCCTTTTAAGTGCCCTGTGCCTAGC
TGCTGCCGCTCCGGATGCAGAGATTGTTGACCTGGTGTCCGATGTCAATG
CCGATAGCTATAGCTACAAATTTGAGACAAGCGATGGCACCAAGCAGGAG
CAGCACGGCTCCCTGAAGAGCCTTGGTCCCGAGGAGGATGCCTTGCAGGT
GGCCGGATCCTTCAGCTTCGTAGGAGACGACGGACAGACGCATGCCATCA
GCTACGTGGCCGATGAGAACGGATTCCAACCCCAGGGCGAGGATATTCCC
CACCTATAACACTTCTATAGTGTCACC

RT02902.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Aa-RA 338 Lcp65Aa-RA 30..338 1..309 1545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6143882..6144190 1..309 1545 100 Plus
chr3L 24539361 chr3L 6140902..6141158 29..285 1150 96.5 Plus
chr3L 24539361 chr3L 6140143..6140226 287..204 180 81 Minus
chr3L 24539361 chr3L 6143014..6143097 287..204 180 81 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65APsi-RA 312 CR18775-RA 50..306 29..285 1150 96.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6151333..6151641 1..309 1545 100 Plus
3L 28110227 3L 6148353..6148609 29..285 1150 96.5 Plus
3L 28110227 3L 6147594..6147677 287..204 180 81 Minus
3L 28110227 3L 6150465..6150548 287..204 180 81 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6144433..6144741 1..309 1545 100 Plus
3L 28103327 3L 6141453..6141709 29..285 1150 96.4 Plus
Blast to na_te.dros performed on 2019-03-16 08:34:03 has no hits.

RT02902.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:34:48 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6143882..6144190 1..309 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:03 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 1..309 1..309 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:56 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 1..309 1..309 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:33 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 1..309 1..309 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:44:04 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 1..309 1..309 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:42:13 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65APsi-RA 50..312 29..290 95   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:03 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 1..309 1..309 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:56 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 30..338 1..309 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:33 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 30..338 1..309 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:44:04 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Aa-RA 30..338 1..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:48 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6151333..6151641 1..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:48 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6151333..6151641 1..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:48 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6151333..6151641 1..309 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:33 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6144433..6144741 1..309 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:23 Download gff for RT02902.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6144433..6144741 1..309 100   Plus

RT02902.pep Sequence

Translation from 0 to 308

> RT02902.pep
MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNADSYSYKFETSDGTKQE
QHGSLKSLGPEEDALQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP
HL*

RT02902.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23527-PA 103 GF23527-PA 1..103 1..102 367 65 Plus
Dana\GF10921-PA 101 GF10921-PA 1..96 1..100 260 51 Plus
Dana\GF10925-PA 107 GF10925-PA 18..97 21..100 250 57.5 Plus
Dana\GF23521-PA 109 GF23521-PA 27..105 24..102 236 51.9 Plus
Dana\GF23526-PA 115 GF23526-PA 32..110 22..100 227 54.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15328-PA 102 GG15328-PA 1..102 1..102 415 77.5 Plus
Dere\GG15326-PA 109 GG15326-PA 21..105 20..102 247 54.1 Plus
Dere\GG14079-PA 106 GG14079-PA 26..101 25..100 237 55.3 Plus
Dere\GG15325-PA 108 GG15325-PA 7..105 5..101 233 45.5 Plus
Dere\GG14083-PA 105 GG14083-PA 1..100 1..100 228 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15650-PA 101 GH15650-PA 1..99 1..102 266 50 Plus
Dgri\GH15651-PA 99 GH15651-PA 1..97 1..100 251 48 Plus
Dgri\GH15837-PA 104 GH15837-PA 1..103 1..101 250 47.6 Plus
Dgri\GH15648-PA 99 GH15648-PA 1..97 1..100 246 47 Plus
Dgri\GH13967-PA 99 GH13967-PA 1..97 1..100 231 44 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Aa-PA 102 CG7287-PA 1..102 1..102 520 100 Plus
Lcp65Ac-PA 109 CG6956-PA 4..105 3..102 268 49 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..97 1..100 251 51 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..97 1..100 251 51 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..97 1..100 251 51 Plus
Lcp65Af-PA 100 CG10533-PA 1..95 1..100 238 47 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..100 1..100 238 44 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..100 1..100 238 44 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..100 1..100 235 43 Plus
Lcp65Ad-PB 108 CG6955-PB 1..104 1..100 234 43.3 Plus
Lcp65Ad-PA 108 CG6955-PA 1..104 1..100 234 43.3 Plus
Lcp65Ae-PA 99 CG10529-PA 1..96 1..100 224 44 Plus
Cpr65Av-PA 111 CG32405-PA 5..110 3..101 216 41.5 Plus
Lcp65Ab1-PA 104 CG32400-PA 1..99 1..100 197 46.1 Plus
Lcp65Ab2-PA 104 CG18773-PA 1..99 1..100 197 46.1 Plus
Acp65Aa-PA 105 CG10297-PA 2..104 1..100 196 36.9 Plus
Cpr65Aw-PA 117 CG32404-PA 11..106 4..102 189 40 Plus
Cpr65Az-PA 239 CG12330-PA 113..193 22..100 189 49.4 Plus
Cpr65Aw-PB 86 CG32404-PB 11..75 38..102 171 49.2 Plus
Cpr49Af-PB 126 CG8510-PB 1..98 1..100 170 36.6 Plus
Cpr49Af-PA 126 CG8510-PA 1..98 1..100 170 36.6 Plus
Cpr47Ea-PA 135 CG9079-PA 49..119 31..100 166 43.7 Plus
Cpr49Aa-PB 144 CG30045-PB 4..109 3..100 165 38.9 Plus
Cpr47Ef-PD 601 CG13214-PD 130..212 19..100 154 34.9 Plus
Cpr47Ef-PC 612 CG13214-PC 130..212 19..100 154 34.9 Plus
Cpr78Cc-PA 119 CG7658-PA 7..96 9..100 153 40.4 Plus
Cpr65Au-PB 106 CG18778-PB 8..101 6..95 152 37.2 Plus
Cpr65Au-PA 106 CG18778-PA 8..101 6..95 152 37.2 Plus
Cpr49Ad-PA 166 CG8836-PA 63..140 19..94 150 41 Plus
Cpr49Ae-PA 134 CG8505-PA 5..109 3..100 149 36.2 Plus
Lcp9-PA 92 CG16914-PA 1..88 1..95 145 35.8 Plus
Cpr65Eb-PA 179 CG8638-PA 9..101 4..100 141 33.7 Plus
Cpr11B-PB 195 CG2555-PB 75..147 30..100 141 36.5 Plus
Cpr11B-PA 197 CG2555-PA 75..147 30..100 141 36.5 Plus
Cpr49Ab-PA 259 CG30042-PA 161..235 25..100 140 36.8 Plus
Cpr47Eb-PA 214 CG13224-PA 5..111 3..100 136 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12620-PA 104 GI12620-PA 1..104 1..102 255 46.2 Plus
Dmoj\GI12628-PA 104 GI12628-PA 1..102 1..100 245 45.1 Plus
Dmoj\GI12627-PA 112 GI12627-PA 1..107 1..100 242 43.9 Plus
Dmoj\GI12698-PA 111 GI12698-PA 1..110 1..101 222 42.7 Plus
Dmoj\GI12618-PA 110 GI12618-PA 26..106 22..102 215 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15560-PA 102 GL15560-PA 1..102 1..102 334 58.8 Plus
Dper\GL15558-PA 104 GL15558-PA 21..99 22..100 238 57 Plus
Dper\GL15521-PA 102 GL15521-PA 1..99 1..100 235 45 Plus
Dper\GL15557-PA 109 GL15557-PA 27..105 24..102 233 50.6 Plus
Dper\GL15520-PA 104 GL15520-PA 21..99 22..100 219 50.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20238-PA 102 GA20238-PA 1..102 1..102 327 56.9 Plus
Dpse\GA15076-PA 104 GA15076-PA 21..99 22..100 238 57 Plus
Dpse\GA19982-PA 109 GA19982-PA 27..105 24..102 233 50.6 Plus
Dpse\GA16877-PA 111 GA16877-PA 1..110 1..101 218 44.5 Plus
Dpse\GA23851-PA 104 GA23851-PA 18..99 21..100 218 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14765-PA 102 GM14765-PA 1..102 1..102 489 92.2 Plus
Dsec\GM14760-PA 109 GM14760-PA 21..105 20..102 251 54.1 Plus
Dsec\GM19678-PA 109 GM19678-PA 21..105 20..102 251 54.1 Plus
Dsec\GM13862-PA 101 GM13862-PA 20..98 22..100 224 53.2 Plus
Dsec\GM13865-PA 101 GM13865-PA 1..96 1..100 218 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13943-PA 102 GD13943-PA 1..102 1..102 482 90.2 Plus
Dsim\GD13939-PA 107 GD13939-PA 21..103 20..102 260 55.4 Plus
Dsim\GD13145-PA 98 GD13145-PA 1..95 1..100 227 47 Plus
Dsim\GD14953-PA 101 GD14953-PA 1..96 1..100 220 45 Plus
Dsim\GD13150-PA 105 GD13150-PA 28..100 28..100 218 53.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12742-PA 102 GJ12742-PA 1..101 1..101 275 55.4 Plus
Dvir\GJ12680-PA 105 GJ12680-PA 1..100 1..100 249 51 Plus
Dvir\GJ12681-PA 105 GJ12681-PA 1..100 1..100 249 51 Plus
Dvir\GJ12738-PA 110 GJ12738-PA 8..107 4..101 236 43 Plus
Dvir\GJ12683-PA 111 GJ12683-PA 1..110 1..101 219 40.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17269-PA 108 GK17269-PA 7..104 5..102 264 50 Plus
Dwil\GK17266-PA 115 GK17266-PA 11..111 3..100 253 49.5 Plus
Dwil\GK16921-PA 105 GK16921-PA 1..100 1..100 252 47.6 Plus
Dwil\GK16914-PA 104 GK16914-PA 1..99 1..100 243 47 Plus
Dwil\GK16922-PA 108 GK16922-PA 1..103 1..100 238 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20503-PA 102 GE20503-PA 1..102 1..102 457 86.3 Plus
Dyak\GE21543-PA 108 GE21543-PA 26..105 22..101 220 50 Plus
Dyak\GE20507-PA 111 GE20507-PA 5..110 3..101 209 43.4 Plus
Dyak\GE20502-PA 195 GE20502-PA 2..105 1..101 197 36.5 Plus
Dyak\GE20506-PA 108 GE20506-PA 6..106 5..102 195 39.6 Plus
Dyak\GE20502-PA 195 GE20502-PA 130..193 39..100 149 50 Plus

RT02902.hyp Sequence

Translation from 1 to 308

> RT02902.hyp
MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNADSYSYKFETSDGTKQE
QHGSLKSLGPEEDALQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP
HL*

RT02902.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Aa-PA 102 CG7287-PA 1..102 1..102 520 100 Plus
Lcp65Ac-PA 109 CG6956-PA 4..105 3..102 268 49 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..97 1..100 251 51 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..97 1..100 251 51 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..97 1..100 251 51 Plus