BDGP Sequence Production Resources |
Search the DGRC for RT02910
Library: | RT |
Tissue Source: | D melanogaster pooled RNA |
Created by: | |
Date Registered: | 2006-04-14 |
Comments: | TA cloning vector from Invitrogen |
Original Plate Number: | 29 |
Well: | 10 |
Vector: | pCR2.1 |
Associated Gene/Transcript | Obp99d-RA |
Protein status: | RT02910.pep: gold |
Sequenced Size: | 434 |
434 bp assembled on 2010-02-26
GenBank Submission: BT100110.3
> RT02910.complete ATGAATCACTTGAGACTGGAGATCATCTGCTGGAGCTGCCTGCTTATTGC GATGGCTGTTAGCACGGAAGCTGCTTCTGTTTGGAAACTACCCACCGCGC AGATGGTCTACGAGGATCTAGAGAAGTGTCGCCAAGAAAGCCAAGAAGAG GATGCTGCTACCCTGAGGTGTTTGGTTAAGAAACTGGGTCTTTGGACGGA TGAGAGTGGCTACAATGCCAGGCGGATAGCAAAGATCTTTGCCGGACACA ACCAGATGGAGGAGCTGATGCTGGTGGTGGAGCACTGCAACCGGATGGAG CAGGACACGAGCCACCTGGACGACTGGGCCTTCCTGGCCTACAGGTGCGC CACTTCCGGGCAGTTTGGCCATTGGGTCAAGGACTTCATGAGTCAAAAGG AAGTGGAACGATGACACTTCTATAGTGTCACCCT
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp99d-RA | 414 | Obp99d-RA | 1..414 | 1..414 | 2070 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25537135..25537548 | 1..414 | 2040 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29714539..29714952 | 1..414 | 2070 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29455370..29455783 | 1..414 | 2070 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25537135..25537556 | 1..423 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 1..414 | 1..414 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 1..414 | 1..414 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 1..414 | 1..414 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 1..414 | 1..414 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 1..414 | 1..414 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 1..414 | 1..414 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 28..449 | 1..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp99d-RA | 35..456 | 1..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29714539..29714960 | 1..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29714539..29714960 | 1..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29714539..29714960 | 1..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25540261..25540682 | 1..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29455370..29455791 | 1..423 | 99 | Plus |
Translation from 0 to 413
> RT02910.pep MNHLRLEIICWSCLLIAMAVSTEAASVWKLPTAQMVYEDLEKCRQESQEE DAATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRME QDTSHLDDWAFLAYRCATSGQFGHWVKDFMSQKEVER*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23362-PA | 135 | GF23362-PA | 1..133 | 1..133 | 456 | 60.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11681-PA | 137 | GG11681-PA | 1..137 | 1..137 | 647 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14317-PA | 128 | GH14317-PA | 2..109 | 22..129 | 348 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp99d-PA | 137 | CG15505-PA | 1..137 | 1..137 | 734 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10414-PA | 138 | GI10414-PA | 26..133 | 26..132 | 310 | 52.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13903-PA | 147 | GL13903-PA | 17..146 | 7..134 | 451 | 63.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Obp99d-PA | 139 | GA13772-PA | 1..139 | 1..137 | 479 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12806-PA | 135 | GM12806-PA | 1..135 | 1..137 | 654 | 89.8 | Plus |
Dsec\GM11660-PA | 159 | GM11660-PA | 59..152 | 48..131 | 133 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Obp99d-PA | 137 | GD21452-PA | 1..137 | 1..137 | 686 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Obp99d-PA | 134 | GJ10628-PA | 20..131 | 20..131 | 315 | 48.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19209-PA | 135 | GK19209-PA | 6..131 | 5..133 | 383 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23870-PA | 137 | GE23870-PA | 1..137 | 1..137 | 680 | 91.2 | Plus |
Translation from 1 to 413
> RT02910.hyp MNHLRLEIICWSCLLIAMAVSTEAASVWKLPTAQMVYEDLEKCRQESQEE DAATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRME QDTSHLDDWAFLAYRCATSGQFGHWVKDFMSQKEVER*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp99d-PA | 137 | CG15505-PA | 1..137 | 1..137 | 734 | 100 | Plus |