Clone RT02910 Report

Search the DGRC for RT02910

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:10
Vector:pCR2.1
Associated Gene/TranscriptObp99d-RA
Protein status:RT02910.pep: gold
Sequenced Size:434

Clone Sequence Records

RT02910.complete Sequence

434 bp assembled on 2010-02-26

GenBank Submission: BT100110.3

> RT02910.complete
ATGAATCACTTGAGACTGGAGATCATCTGCTGGAGCTGCCTGCTTATTGC
GATGGCTGTTAGCACGGAAGCTGCTTCTGTTTGGAAACTACCCACCGCGC
AGATGGTCTACGAGGATCTAGAGAAGTGTCGCCAAGAAAGCCAAGAAGAG
GATGCTGCTACCCTGAGGTGTTTGGTTAAGAAACTGGGTCTTTGGACGGA
TGAGAGTGGCTACAATGCCAGGCGGATAGCAAAGATCTTTGCCGGACACA
ACCAGATGGAGGAGCTGATGCTGGTGGTGGAGCACTGCAACCGGATGGAG
CAGGACACGAGCCACCTGGACGACTGGGCCTTCCTGGCCTACAGGTGCGC
CACTTCCGGGCAGTTTGGCCATTGGGTCAAGGACTTCATGAGTCAAAAGG
AAGTGGAACGATGACACTTCTATAGTGTCACCCT

RT02910.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99d-RA 414 Obp99d-RA 1..414 1..414 2070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25537135..25537548 1..414 2040 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29714539..29714952 1..414 2070 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29455370..29455783 1..414 2070 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:52:44 has no hits.

RT02910.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:53:58 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25537135..25537556 1..423 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:09 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 1..414 1..414 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:26 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 1..414 1..414 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:43:17 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 1..414 1..414 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:06 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 1..414 1..414 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:09 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 1..414 1..414 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:26 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 1..414 1..414 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:43:17 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 28..449 1..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:06 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99d-RA 35..456 1..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:53:58 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29714539..29714960 1..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:53:58 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29714539..29714960 1..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:53:58 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29714539..29714960 1..423 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:43:17 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25540261..25540682 1..423 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:30:52 Download gff for RT02910.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29455370..29455791 1..423 99   Plus

RT02910.pep Sequence

Translation from 0 to 413

> RT02910.pep
MNHLRLEIICWSCLLIAMAVSTEAASVWKLPTAQMVYEDLEKCRQESQEE
DAATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRME
QDTSHLDDWAFLAYRCATSGQFGHWVKDFMSQKEVER*

RT02910.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23362-PA 135 GF23362-PA 1..133 1..133 456 60.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11681-PA 137 GG11681-PA 1..137 1..137 647 86.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14317-PA 128 GH14317-PA 2..109 22..129 348 59.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99d-PA 137 CG15505-PA 1..137 1..137 734 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10414-PA 138 GI10414-PA 26..133 26..132 310 52.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13903-PA 147 GL13903-PA 17..146 7..134 451 63.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp99d-PA 139 GA13772-PA 1..139 1..137 479 61.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12806-PA 135 GM12806-PA 1..135 1..137 654 89.8 Plus
Dsec\GM11660-PA 159 GM11660-PA 59..152 48..131 133 34 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp99d-PA 137 GD21452-PA 1..137 1..137 686 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp99d-PA 134 GJ10628-PA 20..131 20..131 315 48.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19209-PA 135 GK19209-PA 6..131 5..133 383 56.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23870-PA 137 GE23870-PA 1..137 1..137 680 91.2 Plus

RT02910.hyp Sequence

Translation from 1 to 413

> RT02910.hyp
MNHLRLEIICWSCLLIAMAVSTEAASVWKLPTAQMVYEDLEKCRQESQEE
DAATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRME
QDTSHLDDWAFLAYRCATSGQFGHWVKDFMSQKEVER*

RT02910.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99d-PA 137 CG15505-PA 1..137 1..137 734 100 Plus