Clone RT02911 Report

Search the DGRC for RT02911

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:11
Vector:pCR2.1
Associated Gene/Transcriptbnk-RA
Protein status:RT02911.pep: gold
Sequenced Size:939

Clone Sequence Records

RT02911.complete Sequence

939 bp assembled on 2010-02-26

GenBank Submission: BT099974.3

> RT02911.complete
ATGAGCATCAGCACTTTCAACTTCCAGTTCTACAACTACAAGCTTAGCCC
GTCCTCACCGGGATTCGGCAGCACAGCCTCCCGTTCCTCGTCCTCATGCA
TCAGCGAACTGGAAATGGACATTGATGAGGACATGTCCGCCCAGCCCACC
ATCACCTCCACGCCCAAGCCGCGCTTTACCAGCCAACTGGCCGTGGAACT
GGCCAAAACGGAGCCGGGTAATGGCATATCCCCACTGCGACCCAAATTGC
ATACGGCCCAGAAACGCTGGTCCATGGAGTTGAGGGAAAAAGTGCTGGAA
ATGTCCAAGCGAAATAATGGCCAGGAGAAACCACAAACCGCACGACAGCA
GGAACAGCGACAGCCACAGGAACAGCCACTGCAACAGGAGGAACTGCAGC
ATCAGCAGCAGGAACCCACTGTCACCGACAAAATCAACTTCTTCAACAAG
CTGACCAACACCTTTGAGTCGGGTTTCAGCAAGCTGATGCCCCAAGCAAG
CTCCACCAACAACCGCTTCATAGCCATGTTGCGCACCGCCCGTCCTCAAA
ACGTTGCCACAACCACCGCCAACAGCAGCACCGCCAACAGTTTCCTGGGC
AGCGACCACAGTCTCAGTGGTTCCGTGACCGGACAAGTGCCACCACCCAA
GCCCAAGAGACTGTCGGCCACCACCGCCCAGTTTGCCACTCCCCATGTAC
CAGCCATGGGCGTGGGCAAGGGGGGCAGCCAGCGCAAGTGCTCCCTGCGC
CGCAAGCCTTCGATGGACAAGTCGAGGGCCACCATCTCCCGCCAGAGTTC
CAGTGCCTCAGTACGAACCCAGAACCACGCCATCATGGAGGACCTCAGTC
TAGTGGTTCCCGTGAGATTGCGCATCGCGGAGTACGAGCAGCGCATCTCG
ATGAGTGCTTAGCACTTCTATAGTGTCACCTAAATTCGC

RT02911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
bnk-RA 1572 bnk-RA 162..1073 1..912 4560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27015770..27016681 1..912 4440 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31193385..31194296 1..912 4560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30934216..30935127 1..912 4560 100 Plus
Blast to na_te.dros performed 2019-03-16 18:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2308..2549 336..580 227 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6893 306..415 187 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2373..2515 322..463 172 58.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2616 306..519 157 57 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2590..2810 356..590 144 56.9 Plus

RT02911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:06:37 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27015770..27016112 1..343 99 == Plus
chr3R 27016181..27016681 412..912 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:11 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 1..912 1..912 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:06 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 1..912 1..912 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:27 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 1..912 1..912 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:30:24 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 1..912 1..912 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:10 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 162..1073 1..912 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:06 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 162..1073 1..912 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:27 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 24..935 1..912 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:30:24 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
bnk-RA 24..935 1..912 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:37 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31193385..31194296 1..912 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:37 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31193385..31194296 1..912 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:37 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31193385..31194296 1..912 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:27 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27019107..27020018 1..912 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:33 Download gff for RT02911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30934216..30935127 1..912 100   Plus

RT02911.pep Sequence

Translation from 0 to 911

> RT02911.pep
MSISTFNFQFYNYKLSPSSPGFGSTASRSSSSCISELEMDIDEDMSAQPT
ITSTPKPRFTSQLAVELAKTEPGNGISPLRPKLHTAQKRWSMELREKVLE
MSKRNNGQEKPQTARQQEQRQPQEQPLQQEELQHQQQEPTVTDKINFFNK
LTNTFESGFSKLMPQASSTNNRFIAMLRTARPQNVATTTANSSTANSFLG
SDHSLSGSVTGQVPPPKPKRLSATTAQFATPHVPAMGVGKGGSQRKCSLR
RKPSMDKSRATISRQSSSASVRTQNHAIMEDLSLVVPVRLRIAEYEQRIS
MSA*

RT02911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18417-PA 320 GF18417-PA 1..320 1..303 958 65.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11793-PA 317 GG11793-PA 1..317 1..303 1359 88 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22241-PA 318 GH22241-PA 1..318 1..303 669 49.3 Plus
Dgri\GH13977-PA 318 GH13977-PA 1..318 1..303 663 49 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
bnk-PA 303 CG1480-PA 1..303 1..303 1534 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22320-PA 307 GI22320-PA 1..307 1..303 632 50.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13541-PA 312 GL13541-PA 1..312 1..303 746 58.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13256-PA 310 GA13256-PA 1..310 1..303 751 58.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12923-PA 303 GM12923-PA 1..303 1..303 1573 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21562-PA 303 GD21562-PA 1..303 1..303 1573 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10507-PA 296 GJ10507-PA 1..296 1..303 667 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22615-PA 303 GK22615-PA 1..303 1..303 791 55.8 Plus
Dwil\bnk-PA 300 GK13899-PA 1..300 1..303 786 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10921-PA 315 GE10921-PA 1..315 1..303 1404 89.8 Plus

RT02911.hyp Sequence

Translation from 1 to 911

> RT02911.hyp
MSISTFNFQFYNYKLSPSSPGFGSTASRSSSSCISELEMDIDEDMSAQPT
ITSTPKPRFTSQLAVELAKTEPGNGISPLRPKLHTAQKRWSMELREKVLE
MSKRNNGQEKPQTARQQEQRQPQEQPLQQEELQHQQQEPTVTDKINFFNK
LTNTFESGFSKLMPQASSTNNRFIAMLRTARPQNVATTTANSSTANSFLG
SDHSLSGSVTGQVPPPKPKRLSATTAQFATPHVPAMGVGKGGSQRKCSLR
RKPSMDKSRATISRQSSSASVRTQNHAIMEDLSLVVPVRLRIAEYEQRIS
MSA*

RT02911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
bnk-PA 303 CG1480-PA 1..303 1..303 1534 100 Plus