RT02921.complete Sequence
237 bp assembled on 2010-02-26
GenBank Submission: BT100068.3
> RT02921.complete
ATGGAAATCAAGTTCCTAATTGTCCTGTCCGCTGTCTTGATGATAATTTT
CCTGGGAGCGGAAGAATCACATGCCGACTGCCTTTCCGGAAGATATAGGG
GTTCCTGTGCTGTGTGGCACAGGAAGAAGTGCGTAGATATCTGCCAGAGG
GAAGGGCGAACCAGTGGACACTGCAGCCCCAGTCTAAAATGCTGGTGCGA
AGGATGCTAACACTTCTATAGTGTCACCTAAATTCGC
RT02921.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:36:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drs-l-RA | 210 | Drs-l-RA | 1..210 | 1..210 | 1050 | 100 | Plus |
nc_10387.a | 724 | nc_10387.a | 245..458 | 214..1 | 1040 | 99 | Minus |
Drs-RA | 376 | Drs-RA | 214..263 | 161..210 | 205 | 94 | Plus |
Drs-RA | 376 | Drs-RA | 83..174 | 30..121 | 160 | 78.2 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:52:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3335019..3335228 | 210..1 | 1035 | 99.5 | Minus |
chr3L | 24539361 | chr3L | 3369075..3369255 | 30..210 | 260 | 76.2 | Plus |
chr3L | 24539361 | chr3L | 3316390..3316449 | 150..209 | 195 | 88.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3335579..3335788 | 210..1 | 1050 | 100 | Minus |
3L | 28110227 | 3L | 3369651..3369831 | 30..210 | 260 | 76.2 | Plus |
3L | 28110227 | 3L | 3314448..3314585 | 71..208 | 210 | 76.8 | Plus |
3L | 28110227 | 3L | 3316984..3317043 | 150..209 | 195 | 88.3 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3335579..3335788 | 210..1 | 1050 | 100 | Minus |
3L | 28103327 | 3L | 3369782..3369831 | 161..210 | 205 | 94 | Plus |
3L | 28103327 | 3L | 3316984..3317043 | 150..209 | 195 | 88.3 | Plus |
3L | 28103327 | 3L | 3369651..3369742 | 30..121 | 160 | 78.2 | Plus |
3L | 28103327 | 3L | 3336239..3336289 | 121..71 | 150 | 86.2 | Minus |
3L | 28103327 | 3L | 3336146..3336191 | 208..163 | 140 | 86.9 | Minus |
Blast to na_te.dros performed on 2019-03-15 15:52:01 has no hits.
RT02921.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:52:40 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3335019..3335228 | 1..210 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:13 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-l-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:09 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-l-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:44:25 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl1-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:29 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl1-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:13 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-l-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:09 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drs-l-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:25 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl1-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:29 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl1-RA | 1..210 | 1..210 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:40 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3335579..3335788 | 1..210 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:40 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3335579..3335788 | 1..210 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:40 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3335579..3335788 | 1..210 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:25 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3335579..3335788 | 1..210 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:36 Download gff for
RT02921.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3335579..3335788 | 1..210 | 100 | | Minus |
RT02921.pep Sequence
Translation from 0 to 209
> RT02921.pep
MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQR
EGRTSGHCSPSLKCWCEGC*
RT02921.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:37:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 1..69 | 1..69 | 247 | 65.2 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 1..69 | 1..69 | 246 | 65.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14262-PA | 69 | GG14262-PA | 1..69 | 1..69 | 295 | 79.7 | Plus |
Dere\GG15135-PA | 70 | GG15135-PA | 2..70 | 1..69 | 259 | 66.7 | Plus |
Dere\GG15129-PA | 69 | GG15129-PA | 1..69 | 1..69 | 245 | 65.2 | Plus |
Dere\GG14261-PA | 72 | GG14261-PA | 2..72 | 1..69 | 229 | 60.6 | Plus |
Dere\GG15126-PA | 70 | GG15126-PA | 2..70 | 1..69 | 218 | 59.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 1..69 | 386 | 100 | Plus |
Drs-PA | 70 | CG10810-PA | 2..70 | 1..69 | 278 | 66.7 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 1..69 | 266 | 65.2 | Plus |
Drsl2-PA | 70 | CG32279-PA | 2..70 | 1..69 | 249 | 60.9 | Plus |
Drsl6-PA | 72 | CG32268-PA | 2..72 | 1..69 | 247 | 60.6 | Plus |
Drsl4-PA | 71 | CG32282-PA | 3..71 | 2..69 | 190 | 50.7 | Plus |
Drsl3-PA | 71 | CG32283-PA | 2..71 | 1..69 | 180 | 45.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14055-PA | 69 | GM14055-PA | 1..69 | 1..69 | 335 | 91.3 | Plus |
Dsec\GM14569-PA | 72 | GM14569-PA | 2..70 | 1..69 | 257 | 66.7 | Plus |
Dsec\GM14562-PA | 69 | GM14562-PA | 1..69 | 1..69 | 237 | 63.8 | Plus |
Dsec\GM14560-PA | 70 | GM14560-PA | 2..70 | 1..69 | 230 | 60.9 | Plus |
Dsec\GM14054-PA | 72 | GM14054-PA | 2..72 | 1..69 | 180 | 59.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\dro1-PA | 69 | GD13331-PA | 1..69 | 1..69 | 342 | 94.2 | Plus |
Dsim\Drs-PA | 70 | GD13760-PA | 2..70 | 1..69 | 259 | 66.7 | Plus |
Dsim\dro5-PA | 69 | GD13754-PA | 1..69 | 1..69 | 247 | 65.2 | Plus |
Dsim\dro6-PA | 72 | GD13330-PA | 2..72 | 1..69 | 180 | 59.2 | Plus |
Dsim\dro4-PA | 71 | GD13753-PA | 3..71 | 2..69 | 172 | 50.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20689-PA | 69 | GE20689-PA | 1..69 | 1..69 | 290 | 76.8 | Plus |
Dyak\GE21361-PA | 70 | GE21361-PA | 2..70 | 1..69 | 259 | 66.7 | Plus |
Dyak\GE21355-PA | 69 | GE21355-PA | 1..69 | 1..69 | 244 | 65.2 | Plus |
Dyak\GE20688-PA | 72 | GE20688-PA | 2..72 | 1..69 | 226 | 59.2 | Plus |
Dyak\GE21352-PA | 70 | GE21352-PA | 2..70 | 1..69 | 220 | 58 | Plus |
RT02921.hyp Sequence
Translation from 1 to 209
> RT02921.hyp
MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQR
EGRTSGHCSPSLKCWCEGC*
RT02921.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:49:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 1..69 | 386 | 100 | Plus |
Drs-PA | 70 | CG10810-PA | 2..70 | 1..69 | 278 | 66.7 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 1..69 | 266 | 65.2 | Plus |
Drsl2-PA | 70 | CG32279-PA | 2..70 | 1..69 | 249 | 60.9 | Plus |
Drsl6-PA | 72 | CG32268-PA | 2..72 | 1..69 | 247 | 60.6 | Plus |