Clone RT02922 Report

Search the DGRC for RT02922

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:22
Vector:pCR2.1
Associated Gene/TranscriptOsi11-RA
Protein status:RT02922.pep: gold
Sequenced Size:916

Clone Sequence Records

RT02922.complete Sequence

916 bp assembled on 2009-10-30

GenBank Submission: BT100070.1

> RT02922.complete
ATGGAATCGCGTCTGGGTCTGCTCATCGCCCTGCTGCTGGCGGCCTTTCA
GGCCTGGGCCATGGAAGCACCGTCGAACTATAATCAGAACTCTACTGAGA
GTGGACTGCTGCGGACAGTGCGTCATATCTATGGGCAGTGTGCATATAGC
GAGGACGTTTTCTGGTGCTGCAAGATACAGGGAGTTCGCCTGCTGGGACG
GGCTCTGAAGGTCCCTCAACTGGGGATTGTGGATGGCGTTAGCTTGGTGC
GGCGGGAATCCTTTACCCAGGACACGCGGAGTGGACGCTCTAGCCTGCTC
GAGAGCCAGCTCAGCAATCGCGATCTCGAGCACTTGTCGGGGAAGAGTCT
GGACGCCCTGCTGCTGGAGCGGTTCCTCAACTTTGTCCATAGTCACCAGC
TGCAGGTCAACCTACCACGGTTGCTGCGGTTTGGTGAGCGGAATGTCCAG
GATTGGCTGCTGCACGTGGTCGGCTACTTTATGCCAGCCAGCGAAAGCGA
GGGTCGCAAAAAGAAGGATGACAAAAAGTATCTGGGACCCTTCATTGCCG
CCGTTCTGTTAAAGACCGCTATTCTAAAGATGGCATACCACTCCATTGCC
ATTGTAGCGGGAAAGGCGCTTATTGTGGGCAAGATTGCGCTGATCATCAG
TGCTATAATCGGTCTGAAAAAACTTGTGGGTCACGACGGCGGCGAGAAGA
CCACCTACGAGATCGTCAAGCATCCGCAGGTGCAGCAGAGCCACACATAC
TCGTCCAGCCACCAGGGTGAGTACGATACGGGTGGCCATGACGGAGGATC
CTACCACCGCAGCATCGACGACGAGATGATGATGCAGGACAAGGCTTACC
AGGCCTGGATGCCCCACGTGGCCGCATCCCCTTCGCCCGTCGCCAAGGGA
TCCCGATAACACTTCT

RT02922.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Osi11-RA 909 Osi11-RA 1..909 1..909 4545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2093432..2094340 909..1 4545 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6267780..6268688 909..1 4545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6008611..6009519 909..1 4545 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:54:41 has no hits.

RT02922.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:55:42 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2093432..2094340 1..909 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 16:18:24 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 1..909 1..909 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:37 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 1..909 1..909 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:46 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 1..909 1..909 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:28 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 1..909 1..909 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 16:18:24 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 1..909 1..909 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:37 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 1..909 1..909 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:46 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 70..978 1..909 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:28 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi11-RA 70..978 1..909 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:42 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6267780..6268688 1..909 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:42 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6267780..6268688 1..909 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:42 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6267780..6268688 1..909 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:46 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2093502..2094410 1..909 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:13 Download gff for RT02922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6008611..6009519 1..909 100   Minus

RT02922.pep Sequence

Translation from 0 to 908

> RT02922.pep
MESRLGLLIALLLAAFQAWAMEAPSNYNQNSTESGLLRTVRHIYGQCAYS
EDVFWCCKIQGVRLLGRALKVPQLGIVDGVSLVRRESFTQDTRSGRSSLL
ESQLSNRDLEHLSGKSLDALLLERFLNFVHSHQLQVNLPRLLRFGERNVQ
DWLLHVVGYFMPASESEGRKKKDDKKYLGPFIAAVLLKTAILKMAYHSIA
IVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHPQVQQSHTY
SSSHQGEYDTGGHDGGSYHRSIDDEMMMQDKAYQAWMPHVAASPSPVAKG
SR*

RT02922.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18624-PA 305 GF18624-PA 1..305 1..302 1314 84.6 Plus
Dana\GF16388-PA 277 GF16388-PA 10..244 8..265 207 30.2 Plus
Dana\GF16383-PA 295 GF16383-PA 11..215 5..226 189 30.8 Plus
Dana\GF16381-PA 232 GF16381-PA 61..217 76..255 184 36.3 Plus
Dana\GF16380-PA 273 GF16380-PA 56..261 37..288 176 26.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10544-PA 302 GG10544-PA 1..302 1..302 1423 94 Plus
Dere\GG13248-PA 278 GG13248-PA 54..243 47..269 203 30.7 Plus
Dere\GG13161-PA 233 GG13161-PA 61..215 76..253 181 36.1 Plus
Dere\GG13155-PA 274 GG13155-PA 58..262 37..288 178 26.2 Plus
Dere\GG13181-PA 295 GG13181-PA 46..216 38..226 164 30.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14282-PA 326 GH14282-PA 25..300 20..289 1124 80.1 Plus
Dgri\GH14025-PA 231 GH14025-PA 61..218 76..256 194 36.1 Plus
Dgri\GH14024-PA 281 GH14024-PA 65..230 37..222 173 29.4 Plus
Dgri\GH14027-PA 306 GH14027-PA 34..217 24..226 171 28.2 Plus
Dgri\GH14033-PA 276 GH14033-PA 51..222 46..242 169 29.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Osi11-PA 302 CG15596-PA 1..302 1..302 1554 100 Plus
Osi7-PA 288 CG1153-PA 43..285 43..288 256 33.3 Plus
Osi8-PA 274 CG15591-PA 44..262 26..288 228 28.1 Plus
Osi9-PA 233 CG15592-PA 61..215 76..253 220 34.1 Plus
Osi16-PA 278 CG31561-PA 54..256 47..267 203 30.9 Plus
Osi21-PA 282 CG14925-PA 54..231 40..238 196 29.7 Plus
Osi12-PA 295 CG1154-PA 9..216 2..226 191 29.7 Plus
Osi14-PA 268 CG1155-PA 11..253 12..275 157 25.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23173-PA 316 GI23173-PA 1..293 1..288 1179 79.3 Plus
Dmoj\GI24397-PA 232 GI24397-PA 61..215 76..253 187 36.1 Plus
Dmoj\GI24396-PA 285 GI24396-PA 54..234 29..222 186 29.8 Plus
Dmoj\GI24400-PA 289 GI24400-PA 28..217 20..227 178 31 Plus
Dmoj\GI18143-PA 287 GI18143-PA 62..241 37..238 167 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23479-PA 317 GL23479-PA 1..317 1..302 1152 78.2 Plus
Dper\GL24070-PA 277 GL24070-PA 53..241 46..263 208 32.3 Plus
Dper\GL24061-PA 232 GL24061-PA 61..218 76..256 188 34.9 Plus
Dper\GL24063-PA 307 GL24063-PA 42..220 31..226 179 31.3 Plus
Dper\GL24060-PA 291 GL24060-PA 66..239 37..222 175 29.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13838-PA 317 GA13838-PA 1..312 1..298 1104 77.9 Plus
Dpse\GA16326-PA 277 GA16326-PA 53..241 46..263 210 32.3 Plus
Dpse\GA13834-PA 232 GA13834-PA 61..218 76..256 188 34.9 Plus
Dpse\GA11059-PA 310 GA11059-PA 45..223 31..226 179 31.3 Plus
Dpse\GA13833-PA 287 GA13833-PA 66..235 37..222 171 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10562-PA 302 GM10562-PA 1..302 1..302 1456 95.7 Plus
Dsec\GM10879-PA 278 GM10879-PA 47..243 40..269 208 30.2 Plus
Dsec\GM10870-PA 233 GM10870-PA 61..215 76..253 181 36.1 Plus
Dsec\GM10872-PA 295 GM10872-PA 46..216 38..226 160 29.9 Plus
Dsec\GM10868-PA 275 GM10868-PA 43..217 43..239 159 34.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19553-PA 302 GD19553-PA 1..302 1..302 1569 97.4 Plus
Dsim\GD19859-PA 278 GD19859-PA 54..243 47..269 202 30.7 Plus
Dsim\GD19850-PA 233 GD19850-PA 61..215 76..253 181 36.1 Plus
Dsim\GD22180-PA 284 GD22180-PA 54..233 40..238 160 28.5 Plus
Dsim\GD19852-PA 295 GD19852-PA 46..216 38..226 160 29.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14489-PA 321 GJ14489-PA 24..295 20..288 1159 79.9 Plus
Dvir\GJ14913-PA 277 GJ14913-PA 38..231 24..238 194 28.8 Plus
Dvir\GJ14255-PA 231 GJ14255-PA 61..219 76..257 190 35.3 Plus
Dvir\GJ14258-PA 296 GJ14258-PA 32..210 24..226 169 29.9 Plus
Dvir\GJ14251-PA 288 GJ14251-PA 43..230 43..239 154 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14206-PA 316 GK14206-PA 1..316 1..302 1119 77.2 Plus
Dwil\GK18627-PA 289 GK18627-PA 1..267 1..258 1025 77.9 Plus
Dwil\GK13041-PA 298 GK13041-PA 14..218 7..226 188 31.8 Plus
Dwil\GK13048-PA 278 GK13048-PA 53..224 46..242 177 31.2 Plus
Dwil\GK20226-PA 97 GK20226-PA 1..90 120..226 159 35.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24110-PA 302 GE24110-PA 1..302 1..302 1427 93.7 Plus
Dyak\GE10192-PA 233 GE10192-PA 61..215 76..253 181 36.1 Plus
Dyak\GE12926-PA 283 GE12926-PA 54..232 40..238 166 28.5 Plus
Dyak\GE10195-PA 298 GE10195-PA 48..218 38..226 164 30.4 Plus
Dyak\GE10190-PA 288 GE10190-PA 43..230 43..239 163 31.7 Plus

RT02922.hyp Sequence

Translation from 1 to 908

> RT02922.hyp
MESRLGLLIALLLAAFQAWAMEAPSNYNQNSTESGLLRTVRHIYGQCAYS
EDVFWCCKIQGVRLLGRALKVPQLGIVDGVSLVRRESFTQDTRSGRSSLL
ESQLSNRDLEHLSGKSLDALLLERFLNFVHSHQLQVNLPRLLRFGERNVQ
DWLLHVVGYFMPASESEGRKKKDDKKYLGPFIAAVLLKTAILKMAYHSIA
IVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHPQVQQSHTY
SSSHQGEYDTGGHDGGSYHRSIDDEMMMQDKAYQAWMPHVAASPSPVAKG
SR*

RT02922.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Osi11-PA 302 CG15596-PA 1..302 1..302 1554 100 Plus
Osi7-PA 288 CG1153-PA 43..285 43..288 256 33.3 Plus
Osi8-PA 274 CG15591-PA 44..262 26..288 228 28.1 Plus
Osi9-PA 233 CG15592-PA 61..215 76..253 220 34.1 Plus
Osi16-PA 278 CG31561-PA 54..256 47..267 203 30.9 Plus