Clone RT02924 Report

Search the DGRC for RT02924

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:24
Vector:pCR2.1
Associated Gene/TranscriptRpS28a-RA
Protein status:RT02924.pep: gold
Sequenced Size:198

Clone Sequence Records

RT02924.complete Sequence

198 bp assembled on 2009-10-30

GenBank Submission: BT100071.1

> RT02924.complete
ATGGACAAGCCTCAGTACGCTCGCGTGGTCGAGATCCTTGGACGCACTGG
ATCCCAAGGGCAGTGCACCCAGGTGCGGGTGGAGTTCCTCGGCGACCAAA
GCCGCCAGATTATTCGGAATGTCAAAGGACCTGTTCGCGTGGGCGACATC
CTGTCGCTGCTGGAAACTGAACGCGAGGCCAGGAGACTGCGCTGACAC

RT02924.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28a-RA 195 RpS28a-RA 1..195 1..195 975 100 Plus
RpS28b-RA 999 RpS28b-RA 222..372 43..193 335 81.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25844819..25845013 195..1 975 100 Minus
chrX 22417052 chrX 9446468..9446618 43..193 335 81.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30022404..30022598 195..1 975 100 Minus
X 23542271 X 9554755..9554905 43..193 335 81.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29763235..29763429 195..1 975 100 Minus
X 23527363 X 9562853..9563003 43..193 335 81.4 Plus
Blast to na_te.dros performed on 2019-03-15 12:50:01 has no hits.

RT02924.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:51:02 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25844816..25845013 1..198 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 16:18:23 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..195 1..195 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:35 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..195 1..195 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:44 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..195 1..195 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:11:28 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..195 1..195 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 16:18:23 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..195 1..195 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:35 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..195 1..195 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:44 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 51..245 1..198 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:11:28 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 51..245 1..198 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:02 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30022401..30022598 1..198 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:02 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30022401..30022598 1..198 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:02 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30022401..30022598 1..198 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:44 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25848123..25848320 1..198 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:12 Download gff for RT02924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29763232..29763429 1..198 98   Minus

RT02924.pep Sequence

Translation from 0 to 194

> RT02924.pep
MDKPQYARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDI
LSLLETEREARRLR*

RT02924.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21783-PA 55 GF21783-PA 1..55 1..64 199 67.7 Plus
Dana\GF22740-PA 76 GF22740-PA 9..59 7..57 131 51 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11974-PA 64 GG11974-PA 1..64 1..64 284 87.5 Plus
Dere\GG18316-PA 65 GG18316-PA 1..65 1..64 267 81.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12901-PA 65 GH12901-PA 1..65 1..64 267 81.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28a-PA 64 CG15527-PA 1..64 1..64 319 100 Plus
RpS28b-PB 65 CG2998-PB 1..65 1..64 264 81.5 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..64 264 81.5 Plus
RpS28-like-PA 76 CG34182-PA 9..59 7..57 128 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14378-PA 65 GI14378-PA 1..65 1..64 267 81.5 Plus
Dmoj\GI17640-PA 65 GI17640-PA 1..54 1..53 128 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15566-PA 65 GA15566-PA 1..65 1..64 267 81.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12191-PA 136 GM12191-PA 77..136 5..64 282 93.3 Plus
Dsec\GM11375-PA 65 GM11375-PA 1..65 1..64 267 81.5 Plus
Dsec\GM17455-PA 76 GM17455-PA 9..59 7..57 130 51 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16052-PA 65 GD16052-PA 1..65 1..64 267 81.5 Plus
Dsim\GD23606-PA 76 GD23606-PA 9..59 7..57 125 49 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19416-PA 65 GJ19416-PA 1..65 1..64 267 81.5 Plus
Dvir\GJ18205-PA 65 GJ18205-PA 8..63 7..62 132 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25380-PA 65 GK25380-PA 1..65 1..64 267 81.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23424-PA 64 GE23424-PA 1..64 1..64 294 89.1 Plus
Dyak\GE17798-PA 65 GE17798-PA 1..65 1..64 267 81.5 Plus

RT02924.hyp Sequence

Translation from 1 to 194

> RT02924.hyp
MDKPQYARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDI
LSLLETEREARRLR*

RT02924.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28a-PA 64 CG15527-PA 1..64 1..64 319 100 Plus
RpS28b-PB 65 CG2998-PB 1..65 1..64 264 81.5 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..64 264 81.5 Plus
RpS28-like-PA 76 CG34182-PA 9..59 7..57 128 49 Plus