Clone RT02925 Report

Search the DGRC for RT02925

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:25
Vector:pCR2.1
Associated Gene/Transcriptmei-P22-RA
Protein status:RT02925.pep: gold
Sequenced Size:1023

Clone Sequence Records

RT02925.complete Sequence

1023 bp assembled on 2010-02-26

GenBank Submission: BT100073.3

> RT02925.complete
ATGGACAGGACAACAGTTGTCCCGAGTCCGGCCTCCACCTACTGCTCCTT
TATGGGTGGCTCCCAGCACTCCCCATTGCGGCGATCACAGCGCCTCATCG
ACAAGGAAAACCGGGATCTGCAGAAGATTCCGCCCAAAAGTCTTTCTCCT
CAGTTATTTGGAAACACTGAAGATGATTACAGTGAACTATTGTTGCAGCA
AGGGAAAGTGGTTCACCTGAAGCCTGCAGCTAAGTTGGTGCCCGTGAGAT
CCTCGGATAATCTAGTCCATCTTGGATCCCGGGATAAAGTTGTCCCCTTG
AAAACTTCCAATAGAATCGTTCACCTGAAGCCTCCATATAAGATTATCCA
CCTCAAAAGTTTAGATGAAGTTGAAAAGACCGTAAAGAAGAAGAATAATA
TTCAGAAAGAAGTTCATCAAAGGAATTCACAAAGGAGAAGCATTCAATGC
ACTCCCAAAAAACGTGGTCGAAAACCAAAGCAACCGGCTAAGAAACTGCA
GTCAAGAATTTCCACCGATCAGCTAGGAAGCACACCATCGCCATCCAAGC
TGCCTGCCAAATATCCCGCCCATTTTGTTCATCAACTTCCGCCCGCTGAG
GATTCCAGCTGTGCCACTCGAAGACGATCCTTATCTGCTCCAGCTATGCA
ACTTAGCGATCTAAGCCTCACACCCGATGAGATCCAAACTCCGGAGCGGC
GCGGTGAAATCGTAAACAAATCGCCATCGGATCTCGACTCCGATGTCTCC
TTGAACTTCTCGCTGTCCGATTCCATTGGCGAGATCTTCGGCACCAAGGA
CATCAGCAGCATTCTGACCATGCAGCGGCCGCGTCAGTACATTTTGCTGG
AGGAGCATCTGCCCACACTGGCCACCATGTTGAACGTTGACTTGGAGCGA
CTGCGCTGCGTGCTGGATATCACTCAGGGCTTGAGCCACGAGCAAATCCT
GCGCTTTCCGATAAAACATGAAGAGGATGAATTGGAAGTACCTTAGCACT
TCTATAGTGTCACCTAAATTCGC

RT02925.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
mei-P22-RA 996 mei-P22-RA 1..996 1..996 4980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7236547..7237538 1..996 4765 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7244388..7245383 1..996 4980 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7237488..7238483 1..996 4980 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:05:58 has no hits.

RT02925.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:06:38 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7236547..7237540 1..998 98 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:14 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:10 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:31 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:30:26 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:14 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:10 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:31 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:30:26 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
mei-P22-RA 1..996 1..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:38 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7244388..7245385 1..999 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:38 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7244388..7245385 1..999 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:38 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7244388..7245385 1..999 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:31 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7237488..7238485 1..999 99 <- Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:37 Download gff for RT02925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7237488..7238485 1..999 99 <- Plus

RT02925.pep Sequence

Translation from 0 to 995

> RT02925.pep
MDRTTVVPSPASTYCSFMGGSQHSPLRRSQRLIDKENRDLQKIPPKSLSP
QLFGNTEDDYSELLLQQGKVVHLKPAAKLVPVRSSDNLVHLGSRDKVVPL
KTSNRIVHLKPPYKIIHLKSLDEVEKTVKKKNNIQKEVHQRNSQRRSIQC
TPKKRGRKPKQPAKKLQSRISTDQLGSTPSPSKLPAKYPAHFVHQLPPAE
DSSCATRRRSLSAPAMQLSDLSLTPDEIQTPERRGEIVNKSPSDLDSDVS
LNFSLSDSIGEIFGTKDISSILTMQRPRQYILLEEHLPTLATMLNVDLER
LRCVLDITQGLSHEQILRFPIKHEEDELEVP*

RT02925.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10572-PA 323 GF10572-PA 1..314 1..324 561 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14413-PA 329 GG14413-PA 1..328 1..330 1254 77.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15242-PA 256 GH15242-PA 105..237 184..316 186 40.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
mei-P22-PA 331 CG14827-PA 1..331 1..331 1693 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11952-PA 222 GI11952-PA 54..186 184..316 203 36.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25236-PA 475 GL25236-PA 321..471 180..325 381 55 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13278-PA 475 GA13278-PA 321..471 180..325 378 54.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14829-PA 331 GM14829-PA 1..330 1..330 1522 89.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14002-PA 334 GD14002-PA 1..330 1..330 1537 90.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12177-PA 484 GJ12177-PA 316..448 184..316 221 40.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19131-PA 326 GK19131-PA 170..313 161..324 278 41.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mei-P22-PA 330 GE21603-PA 1..329 1..330 1211 75.9 Plus

RT02925.hyp Sequence

Translation from 1 to 995

> RT02925.hyp
MDRTTVVPSPASTYCSFMGGSQHSPLRRSQRLIDKENRDLQKIPPKSLSP
QLFGNTEDDYSELLLQQGKVVHLKPAAKLVPVRSSDNLVHLGSRDKVVPL
KTSNRIVHLKPPYKIIHLKSLDEVEKTVKKKNNIQKEVHQRNSQRRSIQC
TPKKRGRKPKQPAKKLQSRISTDQLGSTPSPSKLPAKYPAHFVHQLPPAE
DSSCATRRRSLSAPAMQLSDLSLTPDEIQTPERRGEIVNKSPSDLDSDVS
LNFSLSDSIGEIFGTKDISSILTMQRPRQYILLEEHLPTLATMLNVDLER
LRCVLDITQGLSHEQILRFPIKHEEDELEVP*

RT02925.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
mei-P22-PA 331 CG14827-PA 1..331 1..331 1693 100 Plus