Clone RT02928 Report

Search the DGRC for RT02928

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:28
Vector:pCR2.1
Associated Gene/TranscriptHP1e-RA
Protein status:RT02928.pep: gold
Sequenced Size:552

Clone Sequence Records

RT02928.complete Sequence

552 bp assembled on 2010-02-26

GenBank Submission: BT100074.3

> RT02928.complete
ATGGATTCAGATGCCGATGGTGGCGAGACCGTTTCGAATTTCTCTGAAAA
TTCGACGGATTTTGAAGAAACTGAGGAGTATATTGTAGAGAGGATTTTGG
ATCGAAGGCATTATATGGGCCAATTACAATACTTGGTCAAATGGCTGGAT
TATAGCGATGAAGATAATACCTGGGAATCGGCAGCAGATCTCGATTGCCA
TTCACTTATTGATTCGATTGAATCACAAAAAAGTCTGAAGAGGGGTCAAG
AGCTGAATAATCAATATGAAACTAAAGCTAAACGACTGAAAATCGATCCA
TGTCTAGTAGTAGATAGTCCTTTTAATCATGGTTTCACTGCACAAGAGAT
TCTAAAAGGCGCTAAAAACAATGGTGAAATATCGTTTTTAATTAGGTTTT
GGCATCTCGATCAACCACAAGTGGTGCCAAGTGGAATTGCATATGTGGAA
ATACCGCAGATGGTTCTGAAATTCTATGAAAATCATTGCAATTTTCACGA
TTATTTAAATAATTATATATCATGACACTTCTATAGTGTCACCTAAATTC
GC

RT02928.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
HP1e-RA 525 HP1e-RA 1..525 1..525 2625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5147564..5148089 1..526 2570 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9321826..9322351 1..526 2630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9062657..9063182 1..526 2630 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:40:24 has no hits.

RT02928.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:41:19 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5147564..5148097 1..539 97 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:15 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:11 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:59 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:19 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:15 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:11 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 57..589 1..534 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:59 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 57..589 1..534 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:19 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
HP1e-RA 57..589 1..534 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:19 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9321826..9322359 1..539 98 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:19 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9321826..9322359 1..539 98 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:19 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9321826..9322359 1..539 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:59 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5147548..5148081 1..539 98 <- Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:38 Download gff for RT02928.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9062657..9063190 1..539 98 <- Plus

RT02928.pep Sequence

Translation from 0 to 524

> RT02928.pep
MDSDADGGETVSNFSENSTDFEETEEYIVERILDRRHYMGQLQYLVKWLD
YSDEDNTWESAADLDCHSLIDSIESQKSLKRGQELNNQYETKAKRLKIDP
CLVVDSPFNHGFTAQEILKGAKNNGEISFLIRFWHLDQPQVVPSGIAYVE
IPQMVLKFYENHCNFHDYLNNYIS*

RT02928.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17204-PA 197 GF17204-PA 44..189 21..165 444 56.2 Plus
Dana\GF15276-PA 210 GF15276-PA 23..205 27..166 259 33.3 Plus
Dana\GF19189-PA 227 GF19189-PA 3..153 26..166 198 32.1 Plus
Dana\GF16710-PA 231 GF16710-PA 8..142 27..169 196 32.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16196-PA 170 GG16196-PA 1..170 1..174 760 80.5 Plus
Dere\GG23468-PA 205 GG23468-PA 15..200 19..166 234 32.8 Plus
Dere\GG18283-PA 238 GG18283-PA 3..153 26..166 200 32.3 Plus
Dere\GG11164-PA 237 GG11164-PA 8..146 27..173 183 28 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10251-PA 203 GH10251-PA 24..198 27..166 251 33.7 Plus
Dgri\GH17802-PA 215 GH17802-PA 3..152 26..166 193 29.9 Plus
Dgri\GH18923-PA 238 GH18923-PA 8..144 27..171 193 28.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
HP1e-PA 174 CG8120-PA 1..174 1..174 933 100 Plus
Su(var)205-PB 206 CG8409-PB 19..201 22..166 239 31.1 Plus
Su(var)205-PA 206 CG8409-PA 19..201 22..166 239 31.1 Plus
HP1b-PB 240 CG7041-PB 3..153 26..166 198 32.9 Plus
HP1b-PC 240 CG7041-PC 3..153 26..166 198 32.9 Plus
HP1b-PA 240 CG7041-PA 3..153 26..166 198 32.9 Plus
HP1c-PA 237 CG6990-PA 8..133 27..160 176 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24000-PA 171 GI24000-PA 16..164 22..165 397 53 Plus
Dmoj\GI15142-PA 211 GI15142-PA 3..153 26..166 197 32.1 Plus
Dmoj\GI23231-PA 234 GI23231-PA 8..146 27..173 191 30.9 Plus
Dmoj\GI20276-PA 180 GI20276-PA 3..147 26..166 184 29.3 Plus
Dmoj\GI15430-PA 226 GI15430-PA 163..221 108..166 164 45.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19396-PA 205 GL19396-PA 27..200 31..166 224 32.2 Plus
Dper\GL23765-PA 229 GL23765-PA 8..141 27..171 179 30.4 Plus
Dper\GL12976-PA 266 GL12976-PA 3..152 26..166 178 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\HP1A-PA 205 GA21056-PA 27..200 31..166 224 32.2 Plus
Dpse\HP1B-PA 234 GA20053-PA 3..152 26..166 179 29.6 Plus
Dpse\HP1C-PA 229 GA20011-PA 8..141 27..171 175 30.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23793-PA 176 GM23793-PA 1..176 1..174 819 88.1 Plus
Dsec\GM13138-PA 206 GM13138-PA 24..201 27..166 235 30.3 Plus
Dsec\GM13712-PA 240 GM13712-PA 3..153 26..166 199 32.3 Plus
Dsec\GM26466-PA 237 GM26466-PA 8..142 27..169 179 28.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18604-PA 176 GD18604-PA 1..176 1..174 830 88.1 Plus
Dsim\GD22433-PA 206 GD22433-PA 24..201 27..166 228 30.3 Plus
Dsim\GD16926-PA 240 GD16926-PA 3..153 26..166 202 32.9 Plus
Dsim\GD20982-PA 237 GD20982-PA 8..142 27..169 178 28.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23632-PA 174 GJ23632-PA 12..159 20..162 385 48.6 Plus
Dvir\Su(var)205-PA 213 GJ17281-PA 24..208 27..166 254 30.8 Plus
Dvir\GJ22891-PA 235 GJ22891-PA 8..138 27..165 194 31 Plus
Dvir\GJ22004-PA 183 GJ22004-PA 3..150 26..166 179 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14980-PA 205 GK14980-PA 12..200 18..166 252 34.7 Plus
Dwil\GK11473-PA 239 GK11473-PA 8..146 27..173 190 28.7 Plus
Dwil\GK16242-PA 277 GK16242-PA 3..155 26..166 187 26.7 Plus
Dwil\GK15187-PA 369 GK15187-PA 7..157 17..165 159 24.7 Plus
Dwil\GK13747-PA 176 GK13747-PA 16..171 18..159 157 27.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25940-PA 173 GE25940-PA 1..173 1..174 767 82.8 Plus
Dyak\Su(var)205-PA 205 GE11133-PA 15..200 19..166 241 32.3 Plus
Dyak\GE15815-PA 240 GE15815-PA 3..153 26..166 200 32.3 Plus
Dyak\GE10331-PA 238 GE10331-PA 8..146 27..173 183 28.7 Plus

RT02928.hyp Sequence

Translation from 1 to 524

> RT02928.hyp
MDSDADGGETVSNFSENSTDFEETEEYIVERILDRRHYMGQLQYLVKWLD
YSDEDNTWESAADLDCHSLIDSIESQKSLKRGQELNNQYETKAKRLKIDP
CLVVDSPFNHGFTAQEILKGAKNNGEISFLIRFWHLDQPQVVPSGIAYVE
IPQMVLKFYENHCNFHDYLNNYIS*

RT02928.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
HP1e-PA 174 CG8120-PA 1..174 1..174 933 100 Plus
Su(var)205-PB 206 CG8409-PB 19..201 22..166 239 31.1 Plus
Su(var)205-PA 206 CG8409-PA 19..201 22..166 239 31.1 Plus
HP1b-PB 240 CG7041-PB 3..153 26..166 198 32.9 Plus
HP1b-PC 240 CG7041-PC 3..153 26..166 198 32.9 Plus