Clone RT02944 Report

Search the DGRC for RT02944

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:44
Vector:pCR2.1
Associated Gene/TranscriptOcho-RB
Protein status:RT02944.pep: gold
Sequenced Size:473

Clone Sequence Records

RT02944.complete Sequence

473 bp assembled on 2010-02-26

GenBank Submission: BT100076.3

> RT02944.complete
ATGTCGGCCATCAGCAAGCAGAAGACCCTCAACACCATGTACAAATCGAA
AGTCTCGCCTTCGCGTCGCCTGAAGAATCTGCTGAAGCCGCTGCTCGGTC
AATTCTTCAACATGAAGAAGGAGCAGCCCAAGAGGAGCTCCTACATCGCC
TCCGAGGAGAAGGAGGCCGAGTTCGAGTGGCTCAGCAACGATATGGACAA
CATGGCCAACGAGCATCTGGAGCATCGCCTCATCGAGGAAATCCGCCAGT
GCGCCAAGGAAGATGCCGTCATCGTTTACAATGAGAACGGATCCGGGGAG
CTGCACACCATCGACCAGGAGGATTACTATGTACCAGTGCATTTTGCCCG
CACCAATGCCGGCACCTTCTTCTGGACATCGGTGCAACCCAAAGCCTGCG
AACCCTATGCCATCGAATGGAACTTCCTGGACCGTTGGGCTCAAGCTTGA
CACTTCTATAGTGTCACCTAAAT

RT02944.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Ocho-RB 1193 Ocho-RB 457..906 1..450 2250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14965371..14965820 1..450 2190 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14975304..14975753 1..450 2250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14968404..14968853 1..450 2250 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:43:15 has no hits.

RT02944.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:44:02 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14965371..14965822 1..453 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:18 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RB 1..450 1..450 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:13 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RB 1..450 1..450 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:14:16 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RC 1..450 1..450 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:05:56 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RC 1..450 1..450 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:17 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RB 457..908 1..453 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:13 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RB 457..908 1..453 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:14:16 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RC 122..573 1..453 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:05:56 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
Ocho-RC 122..573 1..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:44:02 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14975304..14975755 1..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:44:02 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14975304..14975755 1..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:44:02 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14975304..14975755 1..453 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:14:16 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14968404..14968855 1..453 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:41 Download gff for RT02944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14968404..14968855 1..453 99   Plus

RT02944.pep Sequence

Translation from 0 to 449

> RT02944.pep
MSAISKQKTLNTMYKSKVSPSRRLKNLLKPLLGQFFNMKKEQPKRSSYIA
SEEKEAEFEWLSNDMDNMANEHLEHRLIEEIRQCAKEDAVIVYNENGSGE
LHTIDQEDYYVPVHFARTNAGTFFWTSVQPKACEPYAIEWNFLDRWAQA*

RT02944.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24626-PA 149 GF24626-PA 1..149 1..149 720 90.7 Plus
Dana\GF24624-PA 158 GF24624-PA 28..158 22..149 197 38.5 Plus
Dana\GF16797-PA 134 GF16797-PA 53..134 65..149 148 43 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15705-PA 226 GG15705-PA 78..226 1..149 787 96.6 Plus
Dere\GG15703-PA 158 GG15703-PA 28..158 22..149 185 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14634-PA 158 GH14634-PA 1..158 1..149 614 75.3 Plus
Dgri\GH14633-PA 159 GH14633-PA 30..159 24..149 185 38 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ocho-PB 149 CG3396-PB 1..149 1..149 793 100 Plus
Ocho-PC 149 CG3396-PC 1..149 1..149 793 100 Plus
Tom-PA 158 CG5185-PA 28..158 22..149 180 37 Plus
E(spl)malpha-BFM-PA 138 CG8337-PA 10..138 11..149 161 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11347-PA 162 GI11347-PA 18..162 6..149 597 74.5 Plus
Dmoj\GI11346-PA 163 GI11346-PA 30..137 24..128 171 38.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24664-PA 150 GL24664-PA 1..150 1..149 721 89.3 Plus
Dper\GL24642-PA 157 GL24642-PA 27..157 22..149 177 36.3 Plus
Dper\GL21817-PA 143 GL21817-PA 56..143 66..149 143 44.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17423-PA 151 GA17423-PA 1..151 1..149 720 88.7 Plus
Dpse\GA18719-PA 157 GA18719-PA 27..157 22..149 177 36.3 Plus
Dpse\GA21000-PA 143 GA21000-PA 56..143 66..149 143 44.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25493-PA 149 GM25493-PA 1..149 1..149 807 100 Plus
Dsec\GM25490-PA 158 GM25490-PA 28..158 22..149 184 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14513-PA 149 GD14513-PA 1..149 1..149 807 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11601-PA 160 GJ11601-PA 13..160 4..149 621 76.4 Plus
Dvir\GJ11599-PA 159 GJ11599-PA 30..159 24..149 184 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19004-PA 149 GK19004-PA 1..149 1..149 595 74 Plus
Dwil\GK10544-PA 154 GK10544-PA 28..154 22..149 175 38.4 Plus
Dwil\GK14456-PA 142 GK14456-PA 57..142 65..149 134 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22037-PA 149 GE22037-PA 1..149 1..149 793 98 Plus
Dyak\GE22035-PA 158 GE22035-PA 28..158 22..149 184 37.5 Plus

RT02944.hyp Sequence

Translation from 1 to 449

> RT02944.hyp
MSAISKQKTLNTMYKSKVSPSRRLKNLLKPLLGQFFNMKKEQPKRSSYIA
SEEKEAEFEWLSNDMDNMANEHLEHRLIEEIRQCAKEDAVIVYNENGSGE
LHTIDQEDYYVPVHFARTNAGTFFWTSVQPKACEPYAIEWNFLDRWAQA*

RT02944.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Ocho-PB 149 CG3396-PB 1..149 1..149 793 100 Plus
Ocho-PC 149 CG3396-PC 1..149 1..149 793 100 Plus
Tom-PA 158 CG5185-PA 28..158 22..149 180 37 Plus
E(spl)malpha-BFM-PA 138 CG8337-PA 10..138 11..149 161 36.5 Plus