Clone RT03020 Report

Search the DGRC for RT03020

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:30
Well:20
Vector:pCR2.1
Associated Gene/Transcriptlectin-22C-RB
Protein status:RT03020.pep: gold
Sequenced Size:819

Clone Sequence Records

RT03020.complete Sequence

819 bp assembled on 2010-02-26

GenBank Submission: BT100077.3

> RT03020.complete
ATGCTAAAATCCGCAAGTGCTTTGCTATGTGGTCTTCTTGCTTTAAATTT
GTATGGAGCTTGGGCAGAATCCGATGTGATTTGTCCTTTAAAGGACCCTC
CTAGTCAATGTGGAGGATTCTGTCTGGGTGTACTTACGCCCGTGTTAAAT
CACCTGACCATTTCCCAAAATCTGGCGAATTCCAATAATTCAAGCAAGGC
TAACGAGGTCCTGGTGAGACAGTACACGATGGAAGGCCAACTGACTGCTC
TGCAGAATAAGCAACTAAGCATTGAAGTCGCACTGGATGCCCAAGGCAGA
AAACTGAATGTTAACGAACAGAACTTTACTGAACGACTGAATTGCATGGA
AGGCATACTGTCGGCCCTGGAGAAAACAGTCCTTGAAGTAAAAACCAAAA
TAAAATACCTCGGATTCGAGCAAATCGGCTCAAAGTACTATTACATAGAG
AAAGTATCCGAGAAGAACTGGTCCACTGCTTCAAAAACTTGTCGCAATAT
GGGAGGGCACCTGGCCGACATTAAGGACGAGGCAGATCTAGCCGCCATCA
AGGCGAATCTCAAGGAGGACACGCATTACTGGCTGGGAATCAATGACTTG
GACCACGAGGGAAAATTCTTGTCCATGCCCACGGGCAAGCAGACTACCTT
TTTGAAATGGGCCTCGGGGAGACCCTCTCAGTTGGACACCCTCAACTGCG
TGTTCCTATACAACGGGGAAATGTACGATTACCCATGCCACTATACTTTC
CGGTTCATTTGCCAGACCGAGGAGGAAGATTTAAATGTATGACACTTCTA
TAGTGTCACCTAAATTCGC

RT03020.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-22C-RB 792 lectin-22C-RB 1..792 1..792 3960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2036155..2036946 792..1 3960 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2036456..2037247 792..1 3960 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2036456..2037247 792..1 3960 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:17:17 has no hits.

RT03020.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:18:03 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2036151..2036946 1..800 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:19 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 1..792 1..792 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:15 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 1..792 1..792 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:07:52 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 1..792 1..792 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:29 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 1..792 1..792 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:18 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 1..792 1..792 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:15 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 1..792 1..792 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:07:52 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 19..814 1..800 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:29 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-22C-RB 19..814 1..800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:03 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2036452..2037247 1..800 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:03 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2036452..2037247 1..800 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:03 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2036452..2037247 1..800 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:07:52 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2036452..2037247 1..800 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:43 Download gff for RT03020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2036452..2037247 1..800 99   Minus

RT03020.pep Sequence

Translation from 0 to 791

> RT03020.pep
MLKSASALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLN
HLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGR
KLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIE
KVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDL
DHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTF
RFICQTEEEDLNV*

RT03020.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19731-PA 235 GF19731-PA 1..232 32..255 392 34.5 Plus
Dana\GF15691-PA 176 GF15691-PA 23..172 111..256 281 39.3 Plus
Dana\GF14435-PA 432 GF14435-PA 21..205 27..227 267 30.8 Plus
Dana\GF19803-PA 189 GF19803-PA 66..185 139..256 258 41.7 Plus
Dana\GF15345-PA 204 GF15345-PA 46..200 109..257 257 35.5 Plus
Dana\GF14435-PA 432 GF14435-PA 215..425 34..256 246 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24559-PA 1288 GG24559-PA 1..261 1..261 1015 75.9 Plus
Dere\GG21745-PA 255 GG21745-PA 1..255 1..262 442 36.3 Plus
Dere\GG10476-PA 282 GG10476-PA 1..281 1..259 388 33.7 Plus
Dere\GG10503-PA 276 GG10503-PA 1..271 1..255 384 33.7 Plus
Dere\GG24734-PA 269 GG24734-PA 1..265 1..255 321 30.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23701-PA 385 GH23701-PA 158..381 37..256 261 32.9 Plus
Dgri\GH11271-PA 376 GH11271-PA 149..372 37..256 252 31.1 Plus
Dgri\GH10464-PA 197 GH10464-PA 1..194 48..256 245 29.1 Plus
Dgri\GH24460-PA 195 GH24460-PA 46..184 130..258 186 30.7 Plus
Dgri\GH22505-PA 106 GH22505-PA 3..106 157..259 185 34.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-22C-PB 263 CG42295-PB 1..263 1..263 1389 100 Plus
CG15358-PE 252 CG15358-PE 1..252 1..262 395 34.6 Plus
CG15358-PD 252 CG15358-PD 1..252 1..262 395 34.6 Plus
lectin-28C-PC 265 CG7106-PC 30..263 26..258 361 34.3 Plus
lectin-28C-PB 265 CG7106-PB 30..263 26..258 361 34.3 Plus
CG15818-PA 283 CG15818-PA 1..282 1..259 357 32 Plus
lectin-24Db-PA 359 CG2958-PA 199..358 100..259 311 41 Plus
lectin-24A-PA 282 CG3410-PA 1..279 1..255 296 30.9 Plus
lectin-21Cb-PB 249 CG13686-PB 64..247 77..255 287 33.9 Plus
lectin-21Ca-PA 269 CG2826-PA 1..265 1..255 284 31.7 Plus
CG2839-PA 826 CG2839-PA 1..266 1..258 268 28.5 Plus
CG43797-PA 232 CG43797-PA 1..229 1..256 243 26.9 Plus
CG7763-PD 232 CG7763-PD 1..231 1..259 243 28.4 Plus
CG7763-PC 232 CG7763-PC 1..231 1..259 243 28.4 Plus
lectin-30A-PA 223 CG17011-PA 50..223 84..260 242 32.4 Plus
Acp29AB-PA 234 CG17797-PA 42..232 49..258 233 29.4 Plus
lectin-29Ca-PA 236 CG17799-PA 74..234 100..258 228 34.5 Plus
lectin-37Db-PB 150 CG33533-PB 30..148 141..255 204 36.7 Plus
lectin-37Db-PA 150 CG33533-PA 30..148 141..255 204 36.7 Plus
CG12111-PB 188 CG12111-PB 39..177 130..258 182 31.2 Plus
CG12111-PA 188 CG12111-PA 39..177 130..258 182 31.2 Plus
tfc-PC 188 CG9134-PC 56..186 141..257 177 29 Plus
tfc-PA 188 CG9134-PA 56..186 141..257 177 29 Plus
tfc-PB 376 CG9134-PB 244..374 141..257 177 29 Plus
lectin-33A-PB 177 CG16834-PB 26..159 137..257 143 28.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14022-PA 161 GI14022-PA 37..159 142..259 201 35 Plus
Dmoj\GI14792-PA 194 GI14792-PA 45..183 130..258 186 31.2 Plus
Dmoj\GI17697-PA 153 GI17697-PA 17..151 125..257 177 30.1 Plus
Dmoj\GI24628-PA 146 GI24628-PA 28..143 141..256 176 31.6 Plus
Dmoj\GI24639-PA 192 GI24639-PA 57..189 125..257 168 28.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10741-PA 236 GL10741-PA 1..235 1..259 334 33.3 Plus
Dper\GL26845-PA 183 GL26845-PA 9..177 89..256 251 35.6 Plus
Dper\GL26705-PA 277 GL26705-PA 96..276 79..255 244 30.8 Plus
Dper\GL26175-PA 238 GL26175-PA 95..223 135..256 238 40.3 Plus
Dper\GL19670-PA 282 GL19670-PA 108..279 86..260 200 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24466-PA 236 GA24466-PA 1..235 1..259 331 33.7 Plus
Dpse\GA22633-PA 411 GA22633-PA 90..232 36..212 267 35.6 Plus
Dpse\GA29024-PA 277 GA29024-PA 96..276 79..255 241 31.2 Plus
Dpse\GA25561-PA 181 GA25561-PA 11..166 91..256 237 34.1 Plus
Dpse\GA22633-PA 411 GA22633-PA 248..380 89..226 229 37 Plus
Dpse\GA29021-PA 141 GA29021-PA 9..135 139..260 200 33.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16572-PA 450 GM16572-PA 1..123 1..126 423 78 Plus
Dsec\GM16582-PA 268 GM16582-PA 43..268 27..262 385 34.6 Plus
Dsec\GM16433-PA 283 GM16433-PA 1..282 1..259 368 33.1 Plus
Dsec\GM18119-PA 291 GM18119-PA 1..287 1..255 347 32.9 Plus
Dsec\GM18457-PA 255 GM18457-PA 64..252 72..263 318 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22877-PA 230 GD22877-PA 3..230 28..258 1005 81 Plus
Dsim\GD11996-PA 252 GD11996-PA 1..252 1..262 414 34.5 Plus
Dsim\GD23470-PA 283 GD23470-PA 1..282 1..259 374 33.1 Plus
Dsim\GD23494-PA 275 GD23494-PA 1..272 1..258 356 31.7 Plus
Dsim\GD22727-PA 291 GD22727-PA 5..287 6..255 353 32.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16497-PA 252 GJ16497-PA 12..248 37..256 291 32.5 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 11..189 79..259 236 34.1 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 97..224 139..255 228 37.5 Plus
Dvir\GJ18255-PA 159 GJ18255-PA 36..158 139..256 217 34.1 Plus
Dvir\GJ19459-PA 194 GJ19459-PA 45..183 130..258 188 32.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24541-PA 431 GK24541-PA 30..209 36..236 288 33.2 Plus
Dwil\GK19037-PA 249 GK19037-PA 49..245 71..261 227 30.8 Plus
Dwil\GK19210-PA 164 GK19210-PA 35..163 133..257 201 35.7 Plus
Dwil\GK25689-PA 196 GK25689-PA 47..185 130..258 188 29.8 Plus
Dwil\GK18670-PA 255 GK18670-PA 133..229 138..236 185 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15323-PA 368 GE15323-PA 117..368 1..262 419 35.4 Plus
Dyak\GE14642-PA 274 GE14642-PA 23..274 19..261 372 34.5 Plus
Dyak\GE14533-PA 282 GE14533-PA 1..279 1..257 350 30.9 Plus
Dyak\GE16979-PA 269 GE16979-PA 1..268 1..258 288 33 Plus
Dyak\GE15379-PA 226 GE15379-PA 27..226 25..259 280 29.8 Plus

RT03020.hyp Sequence

Translation from 1 to 791

> RT03020.hyp
MLKSASALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLN
HLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGR
KLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIE
KVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDL
DHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTF
RFICQTEEEDLNV*

RT03020.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-22C-PB 263 CG42295-PB 1..263 1..263 1389 100 Plus
CG15358-PC 229 CG15358-PC 4..229 27..262 378 35 Plus
CG15358-PB 229 CG15358-PB 4..229 27..262 378 35 Plus
lectin-28C-PC 265 CG7106-PC 30..263 26..258 361 34.3 Plus
lectin-28C-PB 265 CG7106-PB 30..263 26..258 361 34.3 Plus