Clone RT03039 Report

Search the DGRC for RT03039

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:30
Well:39
Vector:pCR2.1
Associated Gene/TranscriptSfp65A-RA
Protein status:RT03039.pep: gold
Sequenced Size:453

Clone Sequence Records

RT03039.complete Sequence

453 bp assembled on 2010-02-26

GenBank Submission: BT100079.3

> RT03039.complete
ATGGTTTGGATACTGCGACTATTGTCTATCCTTTGCGCCAGCGTTTTAGC
TTATCAGAAAGATGACAGTGCCAATAGCATTATACTTAACGATGGAGCTA
TAACGGTAAACACCTCCACATCGGGACTTACGGAAGCGGAGGGAAATACG
TATGTACCAGGACCTGGATTCTTTCAAGAGACTTTCCTTGGCAAAAAAAC
GATTGGTTCATCTCCTCGATTGCCAGATCTAGGAAATAATATCGTCGTTA
TGAGCGAAAGTAAGCAATTGAAGGCCGGTGAAAAAAACATTGTTAACTCC
AAAGTGCAAACGGTTACAAGAAAGCCCAAAATGTCAAAAGCAGATATATT
TCATGGTATAAAATTATTTCAAGGACCTATTCATGAGCAGTTTGAAAACG
ATCTCCATGACCATCATCACGATTAACACTTCTATAGTGTCACCTAAATT
CGC

RT03039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp65A-RA 554 Sfp65A-RA 35..460 1..426 2130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6342800..6343225 1..426 2085 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6350310..6350735 1..426 2130 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6343410..6343835 1..426 2130 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:54:56 has no hits.

RT03039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:55:49 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6342800..6343231 1..432 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:22 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:39 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:06 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:45 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:22 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 35..466 1..432 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:39 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 35..466 1..432 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:06 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 35..466 1..432 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:45 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp65A-RA 35..466 1..432 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:49 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6350310..6350741 1..432 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:49 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6350310..6350741 1..432 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:49 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6350310..6350741 1..432 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:06 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6343410..6343841 1..432 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:07 Download gff for RT03039.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6343410..6343841 1..432 99   Plus

RT03039.pep Sequence

Translation from 0 to 425

> RT03039.pep
MVWILRLLSILCASVLAYQKDDSANSIILNDGAITVNTSTSGLTEAEGNT
YVPGPGFFQETFLGKKTIGSSPRLPDLGNNIVVMSESKQLKAGEKNIVNS
KVQTVTRKPKMSKADIFHGIKLFQGPIHEQFENDLHDHHHD*

RT03039.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp65A-PA 141 CG42479-PA 1..141 1..141 731 100 Plus

RT03039.hyp Sequence

Translation from 1 to 425

> RT03039.hyp
MVWILRLLSILCASVLAYQKDDSANSIILNDGAITVNTSTSGLTEAEGNT
YVPGPGFFQETFLGKKTIGSSPRLPDLGNNIVVMSESKQLKAGEKNIVNS
KVQTVTRKPKMSKADIFHGIKLFQGPIHEQFENDLHDHHHD*

RT03039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp65A-PA 141 CG42479-PA 1..141 1..141 731 100 Plus