Clone RT03046 Report

Search the DGRC for RT03046

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:30
Well:46
Vector:pCR2.1
Associated Gene/TranscriptTwdlZ-RB
Protein status:RT03046.pep: gold
Sequenced Size:660

Clone Sequence Records

RT03046.complete Sequence

660 bp assembled on 2010-02-26

GenBank Submission: BT100082.3

> RT03046.complete
ATGTTGAACATATTTGTGTGGTTATCACTTTCGTTGATTAGTCTGTCCTG
GGCACAAGGATCGCGTTATTTACCACCACCGAATCCGGCCATGGAACCCA
TCATAACCAAGCAGTTTTACAGCATATCACCCGCCGAAGATCCTGAGGAT
CTGGAGCCAAGAACGAAACACTTGGTGATCGGACAGCCACGCAGGAATTA
CCGAGTGATTTTCATCCGCGCTCCAACGGGAAACAGCGAGCATGTGAAAT
ATACGGCGGAGTTGGCACCTCAGGAGGAGCGAACTGTGATCTATGTGCTG
ACCCGGAAGCAACAGGAATTGGAGGCCGCCGATATTATGGCACCGCAGCA
GAAGTCTCAAGTCGAACAGAAGCCGGATGTATTCTTCATCAAGTACAAAA
CCAACGATGAGGCAGCGGCTGCCCAAAGGGAAATCCAAACGCAATACGAT
CAACTTGGTGGAAATACGGAAATCGCAGCGCCCTATGTGGCGCCCATTAA
ATCGGTGATTGGAGCACTTAGTAGCCCCCAATATCCAGCAGCTCCATATC
CAGTTCAAAGACAATCTCCTGGCTATCACTATGATAGGCCCGATAGGTCC
ACAATCTTGGCGCCAGTGGAACGAACTAACTGACACTTCTATAGTGTCAC
CTAAATTCGC

RT03046.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlZ-RB 633 TwdlZ-RB 1..633 1..633 3165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16627842..16628474 1..633 3165 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16738178..16738810 1..633 3165 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16746276..16746908 1..633 3165 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:50:49 has no hits.

RT03046.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:52:01 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16627842..16628474 1..633 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:23 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:17 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:00:26 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:04:44 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:23 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:17 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:00:26 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:04:44 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlZ-RB 1..633 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:01 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
X 16738178..16738810 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:01 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
X 16738178..16738810 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:01 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
X 16738178..16738810 1..633 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:00:26 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16632211..16632843 1..633 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:46 Download gff for RT03046.complete
Subject Subject Range Query Range Percent Splice Strand
X 16746276..16746908 1..633 100   Plus

RT03046.pep Sequence

Translation from 0 to 632

> RT03046.pep
MLNIFVWLSLSLISLSWAQGSRYLPPPNPAMEPIITKQFYSISPAEDPED
LEPRTKHLVIGQPRRNYRVIFIRAPTGNSEHVKYTAELAPQEERTVIYVL
TRKQQELEAADIMAPQQKSQVEQKPDVFFIKYKTNDEAAAAQREIQTQYD
QLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGYHYDRPDRS
TILAPVERTN*

RT03046.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22661-PA 206 GF22661-PA 1..205 1..209 761 73.6 Plus
Dana\GF22662-PA 385 GF22662-PA 158..304 32..181 383 51.3 Plus
Dana\GF22660-PA 227 GF22660-PA 54..199 8..175 321 45.1 Plus
Dana\GF22658-PA 345 GF22658-PA 138..274 35..174 292 44.3 Plus
Dana\GF16822-PA 238 GF16822-PA 71..212 34..176 279 45.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19074-PA 209 GG19074-PA 1..209 1..210 971 93.3 Plus
Dere\GG19073-PA 247 GG19073-PA 63..215 20..175 434 55.1 Plus
Dere\GG19076-PA 427 GG19076-PA 182..320 32..173 381 52.8 Plus
Dere\GG19072-PA 322 GG19072-PA 123..259 35..174 296 44.3 Plus
Dere\GG11741-PA 269 GG11741-PA 104..243 35..175 279 46.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11917-PA 210 GH11917-PA 13..205 9..197 510 59.7 Plus
Dgri\GH11916-PA 242 GH11916-PA 55..210 15..173 428 54.7 Plus
Dgri\GH11918-PA 355 GH11918-PA 167..304 33..173 358 50.4 Plus
Dgri\GH21845-PA 288 GH21845-PA 102..247 28..175 310 46.4 Plus
Dgri\GH11915-PA 620 GH11915-PA 394..532 33..174 271 41.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlZ-PB 210 CG32569-PB 1..210 1..210 1090 100 Plus
TwdlY-PA 247 CG32570-PA 63..213 20..173 425 53.9 Plus
Twdlalpha-PA 388 CG32574-PA 170..316 32..181 374 51.3 Plus
TwdlG-PC 278 CG14643-PC 107..252 29..175 317 46.4 Plus
TwdlG-PB 278 CG14643-PB 107..252 29..175 317 46.4 Plus
TwdlG-PA 278 CG14643-PA 107..252 29..175 317 46.4 Plus
TwdlV-PA 251 CG14640-PA 76..211 32..173 300 44.4 Plus
TwdlX-PA 346 CG32571-PA 147..282 35..173 295 45.3 Plus
TwdlW-PA 308 CG4060-PA 113..298 19..206 277 34.6 Plus
TwdlF-PA 354 CG14639-PA 138..307 34..205 269 40.6 Plus
TwdlQ-PA 245 CG14250-PA 69..232 29..190 201 34.1 Plus
TwdlD-PA 256 CG14243-PA 67..234 26..194 195 34.5 Plus
TwdlH-PA 241 CG31080-PA 79..231 35..194 190 34.6 Plus
TwdlL-PB 279 CG6447-PB 112..247 27..165 186 35 Plus
TwdlL-PA 285 CG6447-PA 118..253 27..165 186 35 Plus
TwdlO-PA 229 CG6452-PA 50..213 27..201 184 29.4 Plus
TwdlB-PA 286 CG6478-PA 118..253 27..165 183 35 Plus
TwdlP-PA 220 CG14240-PA 51..209 30..192 180 33.7 Plus
TwdlN-PA 309 CG5476-PA 139..266 27..157 179 35.8 Plus
TwdlE-PA 197 CG14534-PA 55..188 29..182 177 30.6 Plus
TwdlM-PA 288 CG5468-PA 122..279 29..194 175 32.3 Plus
TwdlJ-PB 274 CG5471-PB 70..231 19..189 169 30.5 Plus
TwdlK-PA 247 CG6460-PA 67..236 19..194 167 29.6 Plus
Tb-PA 283 CG5480-PA 66..218 9..166 166 34.4 Plus
Twdlbeta-PA 198 CG8986-PA 53..174 23..142 163 32 Plus
TwdlR-PA 325 CG31081-PA 70..212 37..197 161 36.4 Plus
TwdlT-PA 286 CG5812-PA 130..232 34..139 160 33 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14655-PA 206 GI14655-PA 1..204 1..200 579 61.7 Plus
Dmoj\GI14654-PA 562 GI14654-PA 393..532 33..175 402 57.2 Plus
Dmoj\GI14656-PA 374 GI14656-PA 167..304 33..173 370 53.2 Plus
Dmoj\GI21932-PA 273 GI21932-PA 90..234 30..175 311 48 Plus
Dmoj\GI10848-PA 268 GI10848-PA 84..223 33..175 264 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26861-PA 223 GL26861-PA 1..221 1..208 722 69.4 Plus
Dper\GL12334-PA 296 GL12334-PA 130..277 34..182 313 47.7 Plus
Dper\GL26862-PA 259 GL26862-PA 107..213 65..173 281 51.4 Plus
Dper\GL27212-PA 312 GL27212-PA 126..266 34..176 248 39.3 Plus
Dper\GL12309-PA 437 GL12309-PA 264..399 34..175 244 45.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22640-PA 217 GA22640-PA 1..195 1..197 718 73.2 Plus
Dpse\GA16997-PA 254 GA16997-PA 65..217 20..175 429 55.1 Plus
Dpse\GA17001-PA 359 GA17001-PA 150..288 32..173 378 52.8 Plus
Dpse\GA13142-PA 296 GA13142-PA 130..277 34..182 314 47.7 Plus
Dpse\GA16998-PA 344 GA16998-PA 142..279 34..174 295 43.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20532-PA 209 GM20532-PA 1..209 1..210 1043 96.2 Plus
Dsec\GM13464-PA 209 GM13464-PA 1..209 1..210 1043 96.2 Plus
Dsec\GM13463-PA 247 GM13463-PA 63..215 20..175 431 54.4 Plus
Dsec\GM20554-PA 382 GM20554-PA 158..304 32..181 382 51.3 Plus
Dsec\GM13462-PA 346 GM13462-PA 147..283 35..174 291 44.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17303-PA 336 GD17303-PA 142..336 15..210 985 96.9 Plus
Dsim\GD17305-PA 405 GD17305-PA 173..319 32..181 382 51.3 Plus
Dsim\GD17302-PA 346 GD17302-PA 147..283 35..174 295 45 Plus
Dsim\GD19694-PA 278 GD19694-PA 113..252 35..175 274 46.2 Plus
Dsim\GD19709-PA 357 GD19709-PA 141..305 34..190 259 42.4 Plus
Dsim\GD17303-PA 336 GD17303-PA 63..146 20..104 249 54.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19307-PA 194 GJ19307-PA 1..189 1..197 540 58.5 Plus
Dvir\GJ19306-PA 246 GJ19306-PA 64..216 20..175 429 55.1 Plus
Dvir\GJ19308-PA 368 GJ19308-PA 178..315 33..173 359 51.1 Plus
Dvir\GJ14291-PA 281 GJ14291-PA 111..252 33..175 313 49 Plus
Dvir\GJ19305-PA 387 GJ19305-PA 164..302 33..174 297 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25416-PA 248 GK25416-PA 28..193 15..175 582 69.5 Plus
Dwil\GK25415-PA 249 GK25415-PA 61..221 12..175 427 52.4 Plus
Dwil\GK25418-PA 366 GK25418-PA 160..297 33..173 338 55.3 Plus
Dwil\GK25414-PA 339 GK25414-PA 133..269 35..174 272 40.7 Plus
Dwil\GK10882-PA 315 GK10882-PA 129..271 32..176 260 39.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17619-PA 210 GE17619-PA 1..210 1..210 862 88.6 Plus
Dyak\GE17618-PA 247 GE17618-PA 63..215 20..175 431 54.4 Plus
Dyak\GE17621-PA 429 GE17621-PA 198..344 32..181 380 51.3 Plus
Dyak\GE17617-PA 351 GE17617-PA 152..288 35..174 296 45 Plus
Dyak\GE25368-PA 265 GE25368-PA 89..239 24..175 282 45.5 Plus

RT03046.hyp Sequence

Translation from 1 to 632

> RT03046.hyp
MLNIFVWLSLSLISLSWAQGSRYLPPPNPAMEPIITKQFYSISPAEDPED
LEPRTKHLVIGQPRRNYRVIFIRAPTGNSEHVKYTAELAPQEERTVIYVL
TRKQQELEAADIMAPQQKSQVEQKPDVFFIKYKTNDEAAAAQREIQTQYD
QLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGYHYDRPDRS
TILAPVERTN*

RT03046.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlZ-PB 210 CG32569-PB 1..210 1..210 1090 100 Plus
TwdlY-PA 247 CG32570-PA 63..213 20..173 425 53.9 Plus
Twdlalpha-PA 388 CG32574-PA 170..316 32..181 374 51.3 Plus
TwdlG-PC 278 CG14643-PC 107..252 29..175 317 46.4 Plus
TwdlG-PB 278 CG14643-PB 107..252 29..175 317 46.4 Plus