Clone RT03048 Report

Search the DGRC for RT03048

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:30
Well:48
Vector:pCR2.1
Associated Gene/TranscriptIlp1-RA
Protein status:RT03048.pep: gold
Sequenced Size:492

Clone Sequence Records

RT03048.complete Sequence

492 bp assembled on 2010-02-26

GenBank Submission: BT100083.3

> RT03048.complete
ATGTTTAGCCAGCACAACGGTGCAGCAGTACATGGCCTTCGGCTCCAGTC
GCTGCTCATCGCAGCCATGCTCACCGCTGCAATGGCAATGGTCACGCCGA
CTGGCAGTGGTCACCAGTTGCTGCCCCCCGGAAACCACAAACTCTGCGGC
CCCGCACTGTCCGATGCCATGGATGTGGTGTGTCCCCATGGCTTTAATAC
GCTGCCAAGGAAACGTGAAAGCTTGCTGGGCAACAGCGACGACGACGAGG
ACACGGAGCAGGAGGTGCAGGATGATAGCAGCATGTGGCAGACACTGGAC
GGGGCAGGATACTCTTTTAGTCCACTGCTAACCAATCTGTACGGATCCGA
GGTCCTGATCAAGATGCGTCGCCACAGGAGACACCTGACCGGTGGCGTCT
ACGACGAGTGCTGCGTCAAGACCTGCAGCTACTTGGAGTTAGCCATCTAC
TGTCTACCGAAATAGCACTTCTATAGTGTCACCTAAATTCGC

RT03048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp1-RA 465 Ilp1-RA 1..465 1..465 2325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9790196..9790660 1..465 2325 100 Plus
chr2LHet 368865 chr2LHet 193804..194041 1..238 1070 96.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9798434..9798898 1..465 2325 100 Plus
2L 23513712 2L 23338273..23338510 1..238 1070 96.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9791534..9791998 1..465 2325 100 Plus
2L 23513712 2L 23338273..23338510 1..238 1070 96.6 Plus
Blast to na_te.dros performed on 2019-03-16 16:26:03 has no hits.

RT03048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:26:55 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9790196..9790663 1..468 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:25 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:18 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:48 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:27:41 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:24 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:18 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:48 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:27:41 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp1-RA 1..465 1..465 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:55 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9798434..9798901 1..468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:55 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9798434..9798901 1..468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:55 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9798434..9798901 1..468 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:48 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9791534..9792001 1..468 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:47 Download gff for RT03048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9791534..9792001 1..468 99   Plus

RT03048.pep Sequence

Translation from 0 to 464

> RT03048.pep
MFSQHNGAAVHGLRLQSLLIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCG
PALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLD
GAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIY
CLPK*

RT03048.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24677-PA 98 GF24677-PA 1..98 1..126 168 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15411-PA 151 GG15411-PA 1..151 1..154 623 79.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15431-PA 156 GH15431-PA 45..154 41..151 270 49.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp1-PA 154 CG14173-PA 1..154 1..154 823 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13033-PA 129 GI13033-PA 38..128 39..151 245 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16295-PA 133 GL16295-PA 21..133 24..154 323 51.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12803-PA 133 GA12803-PA 21..133 24..154 326 52.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25185-PA 157 GM25185-PA 1..157 1..154 726 87.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14217-PA 156 GD14217-PA 1..156 1..154 686 91.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12130-PA 135 GJ12130-PA 25..133 44..151 135 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10979-PA 148 GK10979-PA 11..130 3..152 208 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21719-PA 154 GE21719-PA 1..154 1..154 674 81.9 Plus

RT03048.hyp Sequence

Translation from 1 to 464

> RT03048.hyp
MFSQHNGAAVHGLRLQSLLIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCG
PALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLD
GAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIY
CLPK*

RT03048.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp1-PA 154 CG14173-PA 1..154 1..154 823 100 Plus