RT03116.complete Sequence
156 bp assembled on 2009-12-09
GenBank Submission: BT100084.2
> RT03116.complete
ATGCATTTCTATCATTTAAATGCGCTTTGCGTGATTATTTTATTAGATTT
GACCAACGCGTTGAATCCAAAGGAAGGATCTACTTTTTGTGTACCTAACT
ATAGAGGATGGTGCTGGGATAGCAATGCGAATGTTTGGACCTACGGAAGA
TAGCAC
RT03116.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:55:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A2-RA | 337 | Sfp33A2-RA | 17..169 | 1..153 | 765 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:07:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11836405..11836557 | 1..153 | 765 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837729..11837881 | 1..153 | 765 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837729..11837881 | 1..153 | 765 | 100 | Plus |
Blast to na_te.dros performed 2019-03-17 00:07:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
GATE | 8507 | GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). | 383..475 | 96..5 | 102 | 58.1 | Minus |
RT03116.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:08:23 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11836405..11836558 | 1..156 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-09 09:13:12 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 1..153 | 1..153 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:47 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 1..153 | 1..153 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:58:34 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 1..153 | 1..153 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:13:12 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 1..153 | 1..153 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-09 09:13:10 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..170 | 1..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:47 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..170 | 1..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:58:34 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..170 | 1..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:13:12 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..170 | 1..156 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:23 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837729..11837882 | 1..156 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:23 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837729..11837882 | 1..156 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:23 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837729..11837882 | 1..156 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:58:34 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11837729..11837882 | 1..156 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:21 Download gff for
RT03116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837729..11837882 | 1..156 | 98 | | Plus |
RT03116.pep Sequence
Translation from 0 to 152
> RT03116.pep
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
*
RT03116.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 1..50 | 293 | 100 | Plus |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 1..50 | 138 | 48 | Plus |
RT03116.hyp Sequence
Translation from 1 to 152
> RT03116.hyp
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
*
RT03116.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 1..50 | 293 | 100 | Plus |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 1..50 | 138 | 48 | Plus |