Clone RT03116 Report

Search the DGRC for RT03116

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:16
Vector:pCR2.1
Associated Gene/TranscriptSfp33A2-RA
Protein status:RT03116.pep: gold
Sequenced Size:156

Clone Sequence Records

RT03116.complete Sequence

156 bp assembled on 2009-12-09

GenBank Submission: BT100084.2

> RT03116.complete
ATGCATTTCTATCATTTAAATGCGCTTTGCGTGATTATTTTATTAGATTT
GACCAACGCGTTGAATCCAAAGGAAGGATCTACTTTTTGTGTACCTAACT
ATAGAGGATGGTGCTGGGATAGCAATGCGAATGTTTGGACCTACGGAAGA
TAGCAC

RT03116.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-RA 337 Sfp33A2-RA 17..169 1..153 765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11836405..11836557 1..153 765 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837729..11837881 1..153 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837729..11837881 1..153 765 100 Plus
Blast to na_te.dros performed 2019-03-17 00:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 383..475 96..5 102 58.1 Minus

RT03116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:08:23 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11836405..11836558 1..156 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-09 09:13:12 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 1..153 1..153 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:47 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 1..153 1..153 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:58:34 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 1..153 1..153 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:13:12 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 1..153 1..153 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-09 09:13:10 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..170 1..156 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:47 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..170 1..156 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:58:34 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..170 1..156 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:13:12 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..170 1..156 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:23 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837729..11837882 1..156 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:23 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837729..11837882 1..156 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:23 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837729..11837882 1..156 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:58:34 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11837729..11837882 1..156 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:21 Download gff for RT03116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837729..11837882 1..156 98   Plus

RT03116.pep Sequence

Translation from 0 to 152

> RT03116.pep
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
*

RT03116.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-PA 50 CG42473-PA 1..50 1..50 293 100 Plus
Sfp33A4-PA 50 CG42604-PA 1..50 1..50 138 48 Plus

RT03116.hyp Sequence

Translation from 1 to 152

> RT03116.hyp
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
*

RT03116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-PA 50 CG42473-PA 1..50 1..50 293 100 Plus
Sfp33A4-PA 50 CG42604-PA 1..50 1..50 138 48 Plus