Clone RT03118 Report

Search the DGRC for RT03118

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:18
Vector:pCR2.1
Associated Gene/TranscriptTwdlJ-RB
Protein status:RT03118.pep: gold
Sequenced Size:828

Clone Sequence Records

RT03118.complete Sequence

828 bp assembled on 2009-10-30

GenBank Submission: BT100085.1

> RT03118.complete
ATGCGTCAGTTCTCCGTAGTTCTTTGCCTGTGCCTCGCCGTTTTGGCCAG
AGCCGATAAACTCGGCTACAATTACCAACCGGTGGCCCACTCTCCCTCCG
GATTGAGCTTCCAGCCATCTGGATCGGCCAGTAGCGATGCACCCGCTTTC
GCGCCTGCACCCAGTGAATCCTTTGGCCCCGGTCCCTCATCCATTGCTGA
TGCCCTGGAAGGATCTCAATCCGCTGCTGCCCCCAACTACGCTGCTCCTC
AGGCCCAACTCGAAAAGGAGTTCTTCACTTACACCGCCGACGAGGGTGAC
TTCTACGACCCAGCTGCCTCCGACCGTGTTGCCAACGCCGTGAACAAGGG
ACTCCGCGTGGTCTTCATCAAGGGACCCGAGAACCGCGGTCTGGAGGATG
CCGCTCTGGCTCTGGCCAAGCAGGCTGCCCAGCAGGAGACCGCCATCTAT
GTCCTGAACAAGCAGGCTGACATTGGAGATCTGGCCAACAAGCTGAACTC
CATCCGCAACAACAACAACAACAAGCCCGAGGTGCACTTCGTCAAGTACC
GCACTCCCGAGGATGCTGCCAACGCCCAGAGTGCAATTCAGGGTCAGTAC
GATCAGTTGGGAGGATCTTCGCAAGCTCAAGATGGTGGAGTGGCATCCAC
CCTGAACTTCGCTTCCCAGCCCGCTCCTGTTCAGGCTGCCAGCAGCCAAG
CGCCCGCCCAGTTCCTGCCCGCCTCCCAGCCCGAGGCTACTGCACCCATC
TCCTCGTATGTGCCACCTGCCACCCCAGGTAGCTCCTACTTGCCCGCCAA
CATCCTGCGCCGCCTGCGTTTCTAACAC

RT03118.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlJ-RB 825 TwdlJ-RB 1..825 1..825 4125 100 Plus
TwdlK-RA 744 TwdlK-RA 34..608 43..617 2590 96.6 Plus
TwdlB-RA 1070 TwdlB-RA 538..866 338..666 1180 90.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22453071..22453895 1..825 4020 99.2 Plus
chr3R 27901430 chr3R 22451154..22451788 677..43 2665 94.6 Minus
chr3R 27901430 chr3R 22445773..22446174 666..265 1185 86.3 Minus
chr3R 27901430 chr3R 22442824..22443153 337..666 1065 88.2 Plus
chr3R 27901430 chr3R 22447880..22448281 666..265 1065 84.3 Minus
chr3R 27901430 chr3R 22455484..22455846 265..627 1035 85.7 Plus
chr3R 27901430 chr3R 22457166..22457563 220..617 955 82.7 Plus
chr3R 27901430 chr3R 22449284..22449563 617..338 710 83.6 Minus
chr3R 27901430 chr3R 22443934..22444184 605..355 385 76.9 Minus
chr3R 27901430 chr3R 22480047..22480165 352..470 325 84.9 Plus
chr3R 27901430 chr3R 22463649..22463814 413..578 245 76.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26629956..26630780 1..825 4125 100 Plus
3R 32079331 3R 26628040..26628674 677..43 2650 94.5 Minus
3R 32079331 3R 26622652..26623053 666..265 1185 86.3 Minus
3R 32079331 3R 26619703..26620032 337..666 1080 88.5 Plus
3R 32079331 3R 26624762..26625163 666..265 1080 84.6 Minus
3R 32079331 3R 26632369..26632731 265..627 1035 85.7 Plus
3R 32079331 3R 26634052..26634449 220..617 955 82.7 Plus
3R 32079331 3R 26626168..26626447 617..338 710 83.6 Minus
3R 32079331 3R 26620813..26621063 605..355 385 76.9 Minus
3R 32079331 3R 26656944..26657062 352..470 325 84.9 Plus
3R 32079331 3R 26640528..26640693 413..578 245 76.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26370787..26371611 1..825 4125 100 Plus
3R 31820162 3R 26368931..26369505 617..43 2590 96.6 Minus
3R 31820162 3R 26363483..26363811 666..338 1180 90.5 Minus
3R 31820162 3R 26360534..26360814 337..617 1060 91.8 Plus
3R 31820162 3R 26365593..26365921 666..338 1060 88.1 Minus
3R 31820162 3R 26373263..26373562 328..627 975 88.3 Plus
3R 31820162 3R 26375004..26375280 341..617 815 86.2 Plus
3R 31820162 3R 26367130..26367278 486..338 535 90.6 Minus
3R 31820162 3R 26397775..26397893 352..470 325 84.8 Plus
3R 31820162 3R 26361644..26361733 605..516 255 85.5 Minus
3R 31820162 3R 26366999..26367087 617..529 250 85.3 Minus
3R 31820162 3R 26381465..26381524 519..578 210 90 Plus
3R 31820162 3R 26374883..26374983 220..320 205 80.1 Plus
3R 31820162 3R 26361779..26361894 470..355 205 78.4 Minus
3R 31820162 3R 26381359..26381411 413..465 175 88.6 Plus
3R 31820162 3R 26366849..26366884 818..783 150 94.4 Minus
3R 31820162 3R 26397945..26398014 522..591 140 80 Plus
Blast to na_te.dros performed on 2019-03-16 10:44:04 has no hits.

RT03118.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:44:59 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22453071..22453895 1..828 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 16:18:12 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 1..825 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:45 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 1..825 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:23 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 1..825 1..825 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:38 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 1..825 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 16:18:12 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 1..825 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:45 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 1..825 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:23 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 39..863 1..828 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:38 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlJ-RB 39..863 1..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:59 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26629956..26630780 1..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:59 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26629956..26630780 1..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:59 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26629956..26630780 1..828 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:23 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22455678..22456502 1..828 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:20 Download gff for RT03118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26370787..26371611 1..828 99   Plus

RT03118.pep Sequence

Translation from 0 to 824

> RT03118.pep
MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAF
APAPSESFGPGPSSIADALEGSQSAAAPNYAAPQAQLEKEFFTYTADEGD
FYDPAASDRVANAVNKGLRVVFIKGPENRGLEDAALALAKQAAQQETAIY
VLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQY
DQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPI
SSYVPPATPGSSYLPANILRRLRF*

RT03118.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16444-PA 262 GF16444-PA 1..262 1..274 863 77.1 Plus
Dana\GF18573-PA 246 GF18573-PA 1..246 1..274 792 70.4 Plus
Dana\GF16446-PA 245 GF16446-PA 3..242 6..270 644 56.8 Plus
Dana\GF18576-PA 281 GF18576-PA 102..281 67..274 589 65.4 Plus
Dana\GF16445-PA 295 GF16445-PA 121..293 79..274 563 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11489-PA 274 GG11489-PA 1..274 1..274 1252 94.2 Plus
Dere\GG12179-PA 239 GG12179-PA 1..238 1..273 994 77.3 Plus
Dere\GG11491-PA 241 GG11491-PA 1..212 1..220 596 67 Plus
Dere\GG12182-PA 288 GG12182-PA 109..288 67..274 575 68.3 Plus
Dere\GG11490-PA 285 GG11490-PA 116..283 82..274 570 66.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18726-PA 286 GH18726-PA 1..286 1..274 945 67 Plus
Dgri\GH18876-PA 232 GH18876-PA 1..232 1..274 758 60 Plus
Dgri\GH18879-PA 271 GH18879-PA 1..270 1..273 647 53.4 Plus
Dgri\GH18728-PA 237 GH18728-PA 1..229 4..255 612 54.7 Plus
Dgri\GH23186-PA 237 GH23186-PA 1..229 4..255 603 53.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlJ-PB 274 CG5471-PB 1..274 1..274 1391 100 Plus
TwdlK-PA 247 CG6460-PA 1..246 1..273 1095 82.1 Plus
TwdlH-PA 241 CG31080-PA 5..238 6..270 755 61.3 Plus
TwdlB-PA 286 CG6478-PA 1..286 1..274 727 55.7 Plus
TwdlL-PA 285 CG6447-PA 1..279 1..242 706 59 Plus
TwdlM-PA 288 CG5468-PA 1..283 1..242 706 57.8 Plus
TwdlL-PB 279 CG6447-PB 1..273 10..242 703 59.5 Plus
TwdlN-PA 309 CG5476-PA 96..307 40..274 646 60.9 Plus
TwdlO-PA 229 CG6452-PA 2..227 3..273 610 52.4 Plus
TwdlD-PA 256 CG14243-PA 1..254 1..273 582 51.3 Plus
TwdlP-PA 220 CG14240-PA 4..219 7..273 547 49.6 Plus
Tb-PA 283 CG5480-PA 1..280 1..267 494 43.1 Plus
TwdlQ-PA 245 CG14250-PA 5..240 8..257 444 41.6 Plus
TwdlR-PA 325 CG31081-PA 60..247 79..262 325 39.8 Plus
TwdlW-PA 308 CG4060-PA 78..306 39..267 247 33.9 Plus
TwdlV-PA 251 CG14640-PA 5..202 6..215 237 34.1 Plus
TwdlF-PA 354 CG14639-PA 1..351 1..266 236 29.2 Plus
Twdlalpha-PA 388 CG32574-PA 117..355 33..268 233 29.8 Plus
TwdlG-PC 278 CG14643-PC 8..241 11..215 229 33.8 Plus
TwdlG-PB 278 CG14643-PB 8..241 11..215 229 33.8 Plus
TwdlG-PA 278 CG14643-PA 8..241 11..215 229 33.8 Plus
TwdlX-PA 346 CG32571-PA 64..272 22..214 214 33.3 Plus
TwdlY-PA 247 CG32570-PA 7..242 6..255 210 30.4 Plus
TwdlS-PA 228 CG14242-PA 37..224 77..256 190 31.6 Plus
TwdlZ-PB 210 CG32569-PB 19..189 70..231 169 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22878-PA 277 GI22878-PA 1..277 1..274 746 61.6 Plus
Dmoj\GI22881-PA 240 GI22881-PA 1..237 4..270 589 47.9 Plus
Dmoj\GI24735-PA 315 GI24735-PA 147..315 79..272 571 66.5 Plus
Dmoj\GI24736-PA 280 GI24736-PA 110..279 79..273 566 66.2 Plus
Dmoj\GI22877-PA 300 GI22877-PA 135..300 82..272 565 66.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23100-PA 293 GL23100-PA 1..293 1..274 943 71.6 Plus
Dper\GL24438-PA 285 GL24438-PA 1..285 1..274 899 65.4 Plus
Dper\GL23102-PA 264 GL23102-PA 4..262 7..271 748 57 Plus
Dper\GL24442-PA 293 GL24442-PA 123..293 79..274 590 68.4 Plus
Dper\GL24441-PA 288 GL24441-PA 118..288 79..274 584 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18905-PB 309 GA18905-PB 1..309 1..274 964 69.3 Plus
Dpse\GA18905-PA 309 GA18905-PA 1..309 1..274 964 69.3 Plus
Dpse\GA26613-PA 250 GA26613-PA 1..250 1..274 893 70.4 Plus
Dpse\GA27141-PA 264 GA27141-PA 4..262 7..271 758 57 Plus
Dpse\GA27140-PB 264 GA27140-PB 1..264 1..272 633 53.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10331-PA 274 GM10331-PA 1..274 1..274 1377 98.2 Plus
Dsec\GM10175-PA 247 GM10175-PA 1..247 1..274 1025 82.5 Plus
Dsec\GM10334-PA 241 GM10334-PA 5..238 6..270 664 59.6 Plus
Dsec\GM10330-PA 265 GM10330-PA 1..265 1..272 612 55.1 Plus
Dsec\GM10332-PA 280 GM10332-PA 111..278 82..274 582 68.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21292-PA 274 GD21292-PA 1..274 1..274 1383 98.5 Plus
Dsim\GD18127-PA 247 GD18127-PA 1..247 1..274 947 82.5 Plus
Dsim\GD21294-PA 241 GD21294-PA 5..238 6..270 668 60.3 Plus
Dsim\GD21293-PA 309 GD21293-PA 140..307 82..274 582 68.4 Plus
Dsim\GD18130-PA 286 GD18130-PA 107..286 67..274 567 67.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14173-PA 284 GJ14173-PA 1..284 1..274 896 65.7 Plus
Dvir\GJ14564-PA 262 GJ14564-PA 1..262 1..274 640 53.8 Plus
Dvir\GJ14563-PA 289 GJ14563-PA 121..289 79..272 638 67.5 Plus
Dvir\GJ14175-PA 232 GJ14175-PA 1..229 4..270 608 51.3 Plus
Dvir\GJ14562-PA 230 GJ14562-PA 2..229 3..274 595 55.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13321-PA 289 GK13321-PA 1..289 1..274 877 71.6 Plus
Dwil\GK13959-PA 262 GK13959-PA 1..262 1..274 812 67 Plus
Dwil\GK13323-PA 246 GK13323-PA 3..243 6..270 630 58.6 Plus
Dwil\GK13960-PA 229 GK13960-PA 2..228 3..274 600 55.6 Plus
Dwil\GK13963-PA 283 GK13963-PA 116..283 82..274 599 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23679-PA 274 GE23679-PA 1..274 1..274 1183 96 Plus
Dyak\GE10623-PA 247 GE10623-PA 1..247 1..274 922 79.9 Plus
Dyak\GE23681-PA 234 GE23681-PA 1..231 1..270 702 61.5 Plus
Dyak\GE23680-PA 302 GE23680-PA 119..300 71..274 599 67.1 Plus
Dyak\GE10626-PA 276 GE10626-PA 97..276 67..274 565 67.3 Plus

RT03118.hyp Sequence

Translation from 1 to 824

> RT03118.hyp
MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAF
APAPSESFGPGPSSIADALEGSQSAAAPNYAAPQAQLEKEFFTYTADEGD
FYDPAASDRVANAVNKGLRVVFIKGPENRGLEDAALALAKQAAQQETAIY
VLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQY
DQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPI
SSYVPPATPGSSYLPANILRRLRF*

RT03118.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlJ-PB 274 CG5471-PB 1..274 1..274 1391 100 Plus
TwdlK-PA 247 CG6460-PA 1..246 1..273 1095 82.1 Plus
TwdlH-PA 241 CG31080-PA 5..238 6..270 755 61.3 Plus
TwdlB-PA 286 CG6478-PA 1..286 1..274 727 55.7 Plus
TwdlL-PA 285 CG6447-PA 1..279 1..242 706 59 Plus