RT03123.complete Sequence
201 bp assembled on 2010-02-26
GenBank Submission: BT100086.3
> RT03123.complete
ATGGAATGGAAACTGCTGCTAATAGTCCTGCCCTGGCTGCTCGTATGTAA
AATTTTTTATAAGGTCGAGGACTTTACGGAGCCTGATGTCGCTTACCAAA
GCATTGACTATCATCCCGAGGACTACATCGATTCCTTCACCGACTTTCAG
AAGCATGACTACTTTCAGTATTGACACTTCTATAGTGTCACCTAAATTCG
C
RT03123.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:36:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ng4-RA | 238 | ng4-RA | 1..174 | 1..174 | 870 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:18:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 3137636..3137809 | 174..1 | 840 | 98.9 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 3244015..3244188 | 174..1 | 870 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 3252113..3252286 | 174..1 | 870 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 15:18:21 has no hits.
RT03123.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:19:28 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 3137626..3137809 | 1..182 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:43 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..174 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:21 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..174 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:08:18 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..174 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:48 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..174 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:42 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..174 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:21 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..174 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:08:18 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 33..206 | 1..174 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:48 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 33..206 | 1..174 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:28 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3244015..3244188 | 1..174 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:28 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3244015..3244188 | 1..174 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:28 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3244015..3244188 | 1..174 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:08:18 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 3138048..3138221 | 1..174 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:50 Download gff for
RT03123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3252113..3252286 | 1..174 | 100 | | Minus |
RT03123.pep Sequence
Translation from 0 to 173
> RT03123.pep
MEWKLLLIVLPWLLVCKIFYKVEDFTEPDVAYQSIDYHPEDYIDSFTDFQ
KHDYFQY*
RT03123.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19610-PA | 61 | GF19610-PA | 9..61 | 5..57 | 206 | 73.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18589-PA | 57 | GG18589-PA | 1..57 | 1..57 | 292 | 100 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ng4-PA | 57 | CG10789-PA | 1..57 | 1..57 | 320 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL19772-PA | 117 | GL19772-PA | 77..117 | 16..56 | 156 | 68.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA10559-PA | 60 | GA10559-PA | 20..60 | 16..56 | 142 | 65.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18839-PA | 57 | GM18839-PA | 1..57 | 1..57 | 287 | 98.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16336-PA | 57 | GD16336-PA | 1..57 | 1..57 | 287 | 98.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16900-PA | 57 | GE16900-PA | 1..57 | 1..57 | 221 | 94.7 | Plus |
RT03123.hyp Sequence
Translation from 1 to 173
> RT03123.hyp
MEWKLLLIVLPWLLVCKIFYKVEDFTEPDVAYQSIDYHPEDYIDSFTDFQ
KHDYFQY*
RT03123.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ng4-PA | 57 | CG10789-PA | 1..57 | 1..57 | 320 | 100 | Plus |