Clone RT03123 Report

Search the DGRC for RT03123

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:23
Vector:pCR2.1
Associated Gene/Transcriptng4-RA
Protein status:RT03123.pep: gold
Sequenced Size:201

Clone Sequence Records

RT03123.complete Sequence

201 bp assembled on 2010-02-26

GenBank Submission: BT100086.3

> RT03123.complete
ATGGAATGGAAACTGCTGCTAATAGTCCTGCCCTGGCTGCTCGTATGTAA
AATTTTTTATAAGGTCGAGGACTTTACGGAGCCTGATGTCGCTTACCAAA
GCATTGACTATCATCCCGAGGACTACATCGATTCCTTCACCGACTTTCAG
AAGCATGACTACTTTCAGTATTGACACTTCTATAGTGTCACCTAAATTCG
C

RT03123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
ng4-RA 238 ng4-RA 1..174 1..174 870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3137636..3137809 174..1 840 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3244015..3244188 174..1 870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3252113..3252286 174..1 870 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:18:21 has no hits.

RT03123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:19:28 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3137626..3137809 1..182 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:43 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..174 1..174 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:21 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..174 1..174 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:08:18 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..174 1..174 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:48 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..174 1..174 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:42 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..174 1..174 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:21 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..174 1..174 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:08:18 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 33..206 1..174 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:48 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 33..206 1..174 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:28 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
X 3244015..3244188 1..174 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:28 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
X 3244015..3244188 1..174 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:28 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
X 3244015..3244188 1..174 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:08:18 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3138048..3138221 1..174 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:50 Download gff for RT03123.complete
Subject Subject Range Query Range Percent Splice Strand
X 3252113..3252286 1..174 100   Minus

RT03123.pep Sequence

Translation from 0 to 173

> RT03123.pep
MEWKLLLIVLPWLLVCKIFYKVEDFTEPDVAYQSIDYHPEDYIDSFTDFQ
KHDYFQY*

RT03123.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19610-PA 61 GF19610-PA 9..61 5..57 206 73.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18589-PA 57 GG18589-PA 1..57 1..57 292 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
ng4-PA 57 CG10789-PA 1..57 1..57 320 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19772-PA 117 GL19772-PA 77..117 16..56 156 68.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10559-PA 60 GA10559-PA 20..60 16..56 142 65.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18839-PA 57 GM18839-PA 1..57 1..57 287 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16336-PA 57 GD16336-PA 1..57 1..57 287 98.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16900-PA 57 GE16900-PA 1..57 1..57 221 94.7 Plus

RT03123.hyp Sequence

Translation from 1 to 173

> RT03123.hyp
MEWKLLLIVLPWLLVCKIFYKVEDFTEPDVAYQSIDYHPEDYIDSFTDFQ
KHDYFQY*

RT03123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
ng4-PA 57 CG10789-PA 1..57 1..57 320 100 Plus