Clone RT03140 Report

Search the DGRC for RT03140

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:40
Vector:pCR2.1
Associated Gene/TranscriptCpr72Eb-RA
Protein status:RT03140.pep: gold
Sequenced Size:681

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12255 2011-03-01 Transcript Validation

Clone Sequence Records

RT03140.complete Sequence

681 bp assembled on 2010-02-26

GenBank Submission: BT100091.3

> RT03140.complete
ATGTACTTCCTTAATCTTTGCCTGATTTGTACCACCATCGGTTTGGCCGT
CGGTTCACCAACCTTGGAGTACGGTCCCCCACCAACTTCGGATACGATCA
GTCAGTATCACCACCAGGATGAGCATGGCCAGTACGCCTATGGTTACATG
GCACCACTGTATTCCAAGCACGAGACCCGCACCGTGGATGGTGTGATCCG
GGGTACCTTCTCCCACATCGATGCAAATGGCGAAACCCAGACCGTGGACT
ATGTGGCCGATGCCGAGGGCTTCCATGTAACCTCCAATCTGCCCAATCAG
CAGGCCAATCAGGAAACCCCTGAAGTGGCTGCACTGCGAACACAGCATCT
GGAGGCCCATAACCAGGCCAAATTGAGGTTGGCCGGAGACTACTCCGTGG
GTCCACAGCCTGTTCGGGACACTCCCGAGGTGGCCGCCGCTAAGGTTGCA
TTCTTCAAGCGTTTCGAAGCCGAGAAGCTGCGCAACAAGTTGCTCGCCGA
GAAGAAAGTTCTGGTGATACCGAATCCAACTCCCATCGCTGTTCGTTCAC
AGCCGATATATGTCTACCAGCCCACCACCACAGGATTCGTGTACAACTAC
CACACCAAGACGCAGGCCCAAGTTCCATCGAGGAACTACCTGCCAGTAGT
CTAACACTTCTATAGTGTCACCTAAATTCGC

RT03140.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr72Eb-RA 654 Cpr72Eb-RA 1..654 1..654 3270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16354736..16355389 1..654 3195 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16364997..16365650 1..654 3270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16358097..16358750 1..654 3270 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:36:01 has no hits.

RT03140.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:37:01 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16354736..16355393 1..659 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:59 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:24 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:20 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:06:45 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:59 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:24 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:20 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 99..756 1..659 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:06:45 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr72Eb-RA 99..756 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:01 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16364997..16365654 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:01 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16364997..16365654 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:01 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16364997..16365654 1..659 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:20 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16358097..16358754 1..659 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:55 Download gff for RT03140.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16358097..16358754 1..659 99   Plus

RT03140.pep Sequence

Translation from 0 to 653

> RT03140.pep
MYFLNLCLICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGYM
APLYSKHETRTVDGVIRGTFSHIDANGETQTVDYVADAEGFHVTSNLPNQ
QANQETPEVAALRTQHLEAHNQAKLRLAGDYSVGPQPVRDTPEVAAAKVA
FFKRFEAEKLRNKLLAEKKVLVIPNPTPIAVRSQPIYVYQPTTTGFVYNY
HTKTQAQVPSRNYLPVV*

RT03140.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10117-PA 218 GF10117-PA 1..218 1..217 825 74.9 Plus
Dana\GF10116-PA 247 GF10116-PA 19..118 1..110 202 44.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16000-PA 216 GG16000-PA 1..215 1..216 1043 91.7 Plus
Dere\GG15999-PA 341 GG15999-PA 36..113 32..108 197 55.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15888-PA 214 GH15888-PA 7..214 4..217 596 57.6 Plus
Dgri\GH15887-PA 230 GH15887-PA 23..198 3..168 289 41.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr72Eb-PA 217 CG12255-PA 1..217 1..217 1147 100 Plus
Cpr72Ea-PA 341 CG4818-PA 36..147 32..138 216 43.8 Plus
Cpr92F-PA 381 CG5494-PA 25..143 34..150 167 39 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16539-PA 216 GI16539-PA 22..216 18..217 598 61 Plus
Dmoj\GI16538-PA 238 GI16538-PA 1..211 1..170 298 41.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17858-PA 218 GL17858-PA 1..218 8..217 728 70.9 Plus
Dper\GL17857-PA 512 GL17857-PA 19..107 1..99 203 48 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11512-PA 226 GA11512-PA 1..226 1..217 744 71.1 Plus
Dpse\GA28517-PA 512 GA28517-PA 19..107 1..99 202 48 Plus
Dpse\GA18926-PA 386 GA18926-PA 25..103 34..111 144 46.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25630-PA 216 GM25630-PA 1..215 1..216 1070 94 Plus
Dsec\GM25629-PA 339 GM25629-PA 36..115 32..110 198 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14634-PA 216 GD14634-PA 1..215 1..216 1098 96.3 Plus
Dsim\GD14633-PA 341 GD14633-PA 36..115 32..110 204 55 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12791-PA 225 GJ12791-PA 20..225 15..217 573 58.7 Plus
Dvir\GJ12790-PA 247 GJ12790-PA 1..247 1..198 294 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14380-PA 213 GK14380-PA 5..212 4..216 576 57.5 Plus
Dwil\GK14271-PA 186 GK14271-PA 40..169 32..174 305 49.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23090-PA 216 GE23090-PA 1..215 1..216 1038 90.7 Plus
Dyak\GE19564-PA 216 GE19564-PA 1..215 1..216 1027 89.8 Plus
Dyak\GE23089-PA 291 GE23089-PA 36..121 32..116 206 52.3 Plus
Dyak\GE19563-PA 291 GE19563-PA 36..121 32..116 206 52.3 Plus

RT03140.hyp Sequence

Translation from 1 to 653

> RT03140.hyp
MYFLNLCLICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGYM
APLYSKHETRTVDGVIRGTFSHIDANGETQTVDYVADAEGFHVTSNLPNQ
QANQETPEVAALRTQHLEAHNQAKLRLAGDYSVGPQPVRDTPEVAAAKVA
FFKRFEAEKLRNKLLAEKKVLVIPNPTPIAVRSQPIYVYQPTTTGFVYNY
HTKTQAQVPSRNYLPVV*

RT03140.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr72Eb-PA 217 CG12255-PA 1..217 1..217 1147 100 Plus
Cpr72Ea-PA 341 CG4818-PA 36..147 32..138 216 43.8 Plus
Cpr92F-PA 381 CG5494-PA 25..143 34..150 167 39 Plus