Clone RT03142 Report

Search the DGRC for RT03142

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:42
Vector:pCR2.1
Associated Gene/TranscriptRdh-RA
Protein status:RT03142.pep: gold
Sequenced Size:232

Clone Sequence Records

RT03142.complete Sequence

232 bp assembled on 2010-02-26

GenBank Submission: BT100092.3

> RT03142.complete
ATGTCCGCCAGCGGTCGTCGCTTCTGTCGCAGCCGTTGCCAAAGTTGTCA
TTGTCATCCGTACCAGCAAACGCAGCAGCAAAAGCAGCAGCAGCAGCAGC
AGCAGCAACATCAGGCAGCAGCAGCAGCAGCAACTAGCAACTAGCAGCAG
CAACATCTATAGGAGAAGCAGAGCCGCAGCAGCAGCAGCAGCAACTAGCA
ACTAGCACTTCTATAGTGTCACCTAAATTCGC

RT03142.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-RA 144 Rdh-RA 1..144 1..144 720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3824968..3825150 1..192 790 95.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3825524..3825715 1..192 960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3825524..3825715 1..192 960 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:41:49 has no hits.

RT03142.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:33 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3824968..3825030 1..63 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:16:00 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 1..144 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:26 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 1..144 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:18 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 1..144 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:32 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 1..144 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:16:00 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 1..144 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:25 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 1..144 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:18 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 76..270 1..197 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:32 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 76..270 1..197 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:33 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3825524..3825718 1..197 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:33 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3825524..3825718 1..197 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:33 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3825524..3825718 1..197 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:18 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3825524..3825718 1..197 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:56 Download gff for RT03142.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3825524..3825718 1..197 98   Plus

RT03142.pep Sequence

Translation from 0 to 143

> RT03142.pep
MSASGRRFCRSRCQSCHCHPYQQTQQQKQQQQQQQQHQAAAAAATSN*

RT03142.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-PA 47 CG14975-PA 1..47 1..47 255 100 Plus

RT03142.hyp Sequence

Translation from 1 to 195

> RT03142.hyp
CPPAVVASVAAVAKVVIVIRTSKRSSKSSSSSSSSNIRQQQQQQLATSSS
NIYRRSRAAAAAAA
Sequence RT03142.hyp has no blast hits.