RT03142.complete Sequence
232 bp assembled on 2010-02-26
GenBank Submission: BT100092.3
> RT03142.complete
ATGTCCGCCAGCGGTCGTCGCTTCTGTCGCAGCCGTTGCCAAAGTTGTCA
TTGTCATCCGTACCAGCAAACGCAGCAGCAAAAGCAGCAGCAGCAGCAGC
AGCAGCAACATCAGGCAGCAGCAGCAGCAGCAACTAGCAACTAGCAGCAG
CAACATCTATAGGAGAAGCAGAGCCGCAGCAGCAGCAGCAGCAACTAGCA
ACTAGCACTTCTATAGTGTCACCTAAATTCGC
RT03142.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:36:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-RA | 144 | Rdh-RA | 1..144 | 1..144 | 720 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3824968..3825150 | 1..192 | 790 | 95.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:41:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3825524..3825715 | 1..192 | 960 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3825524..3825715 | 1..192 | 960 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 00:41:49 has no hits.
RT03142.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:33 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3824968..3825030 | 1..63 | 100 | == | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:16:00 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 1..144 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:26 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 1..144 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:18 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 1..144 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:32 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 1..144 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:16:00 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 1..144 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:25 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 1..144 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:18 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 76..270 | 1..197 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:32 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 76..270 | 1..197 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:33 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3825524..3825718 | 1..197 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:33 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3825524..3825718 | 1..197 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:33 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3825524..3825718 | 1..197 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:18 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3825524..3825718 | 1..197 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:56 Download gff for
RT03142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3825524..3825718 | 1..197 | 98 | | Plus |
RT03142.pep Sequence
Translation from 0 to 143
> RT03142.pep
MSASGRRFCRSRCQSCHCHPYQQTQQQKQQQQQQQQHQAAAAAATSN*
RT03142.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-PA | 47 | CG14975-PA | 1..47 | 1..47 | 255 | 100 | Plus |
RT03142.hyp Sequence
Translation from 1 to 195
> RT03142.hyp
CPPAVVASVAAVAKVVIVIRTSKRSSKSSSSSSSSNIRQQQQQQLATSSS
NIYRRSRAAAAAAA
Sequence RT03142.hyp has no blast hits.