Clone RT03147 Report

Search the DGRC for RT03147

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:47
Vector:pCR2.1
Associated Gene/Transcriptlectin-24A-RA
Protein status:RT03147.pep: gold
Sequenced Size:876

Clone Sequence Records

RT03147.complete Sequence

876 bp assembled on 2010-02-26

GenBank Submission: BT100093.3

> RT03147.complete
ATGTTTAGATTGTCAGTCTTAGTTCTGAACTTACTCCTTGTTAGCCATGA
ATTCTCGGCAGGAACCGCGAAAATTGAAATTCAGCCATTACCTGCCCTAT
GCAACGGATACTGCTTCCCCACCCTGAAGCCAGTTATGGAGTATGTTGCT
ATCCACCAGGACAAATGGAATACTTGTACGGAAATATTAGCGAACGAAGC
CCGCAAGGATCAGATCCAGTTGAATATCCAGCTGGATGCCTTGAAAGCAG
ACGTTTCCAACATAAAGGCATCGCAGCTGTCAAAGGATGAGAAGCTGGAC
AGGATGGAGCGAGAGCAGTTTGCCATGCATGAATCTTTGGAGACCATCAA
TCGGTATCTTACAGTGAAACTGGACAGAACGAAATTGCAGCTTGAGGCGA
TCAAAAACACAATGGATTATATGAAGGCCCAAATGGATGGCTATTTCTCA
GCCATAAATGGAGTTCAATGCCTACAGCCAGGATTTGAGAAGATAGGCGA
TAGATATTTTTACATCGAAGAAGATGTTGAGCTAAATTGGCTGGATGCTC
AGGCCAAATGTCGTCGAATGGGAGGTCACCTAGCCTCTATAAAAACTAAA
CAGGAGTTTGACGCAATCGTAGAGAAGCTCGATGATTCGAAATCATACTT
CCTGGGCGTCAACGAAAACACAAAAACCGGTGACTTTGTGTCTGCAGCCT
CCGGAAAAAGTTGTTTGTATCACGAGTGGGGTCCTGGTGAACCCCATCAC
AATAATGACCAAGAGCGATGCGTTTCAATCTTGCGAAAACTCATGCATGT
GGGCAATTGTACTTATGAAAAAAGATTCATATGCCAGTATGGCATCTAGC
ACTTCTATAGTGTCACCTAAATTCGC

RT03147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-24A-RA 849 lectin-24A-RA 1..849 1..849 4245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3716399..3717248 850..1 4175 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3716879..3717728 850..1 4250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3716879..3717728 850..1 4250 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:16:20 has no hits.

RT03147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:17:09 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3716399..3717248 1..850 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:24:55 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 1..849 1..849 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:29 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 1..849 1..849 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:27 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 1..849 1..849 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:31 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 1..849 1..849 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:24:51 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 1..849 1..849 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:29 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 46..895 1..850 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:27 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 46..895 1..850 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:31 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-24A-RA 46..895 1..850 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:09 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3716879..3717728 1..850 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:09 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3716879..3717728 1..850 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:09 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3716879..3717728 1..850 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:27 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3716879..3717728 1..850 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:00 Download gff for RT03147.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3716879..3717728 1..850 100   Minus

RT03147.pep Sequence

Translation from 0 to 848

> RT03147.pep
MFRLSVLVLNLLLVSHEFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYVA
IHQDKWNTCTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLD
RMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFS
AINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTK
QEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHH
NNDQERCVSILRKLMHVGNCTYEKRFICQYGI*

RT03147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19731-PA 235 GF19731-PA 3..232 31..279 289 29.6 Plus
Dana\GF15345-PA 204 GF15345-PA 49..201 123..282 240 32.5 Plus
Dana\GF15691-PA 176 GF15691-PA 52..173 161..281 237 36.9 Plus
Dana\GF15692-PA 176 GF15692-PA 46..173 155..281 228 35.2 Plus
Dana\GF14434-PA 168 GF14434-PA 32..159 154..279 209 34.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10503-PA 276 GG10503-PA 1..273 1..281 355 28.8 Plus
Dere\GG10476-PA 282 GG10476-PA 38..277 31..279 336 34.1 Plus
Dere\GG21745-PA 255 GG21745-PA 1..248 1..279 321 32.5 Plus
Dere\GG24559-PA 1288 GG24559-PA 34..255 31..279 304 31.6 Plus
Dere\GG24987-PA 449 GG24987-PA 260..444 92..279 297 36.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11271-PA 376 GH11271-PA 145..371 30..279 246 26.6 Plus
Dgri\GH23701-PA 385 GH23701-PA 154..380 30..279 240 26.6 Plus
Dgri\GH10464-PA 197 GH10464-PA 73..171 162..260 200 39 Plus
Dgri\GH24460-PA 195 GH24460-PA 55..181 162..279 183 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-24A-PA 282 CG3410-PA 1..282 1..282 1488 100 Plus
lectin-24Db-PA 359 CG2958-PA 1..354 1..279 357 29.8 Plus
CG15818-PA 283 CG15818-PA 38..278 31..279 343 32.6 Plus
lectin-28C-PC 265 CG7106-PC 41..260 34..279 327 28.9 Plus
lectin-28C-PB 265 CG7106-PB 41..260 34..279 327 28.9 Plus
lectin-22C-PB 263 CG42295-PB 1..255 1..279 296 30.9 Plus
CG15358-PE 252 CG15358-PE 1..245 1..279 291 27.3 Plus
CG15358-PD 252 CG15358-PD 1..245 1..279 291 27.3 Plus
CG2839-PA 826 CG2839-PA 78..263 99..279 276 35.6 Plus
lectin-21Ca-PA 269 CG2826-PA 36..268 38..282 245 28 Plus
lectin-21Cb-PB 249 CG13686-PB 95..247 134..279 217 32.3 Plus
CG7763-PD 232 CG7763-PD 109..230 162..282 211 33.6 Plus
CG7763-PC 232 CG7763-PC 109..230 162..282 211 33.6 Plus
Acp29AB-PA 234 CG17797-PA 67..229 113..279 199 28.6 Plus
lectin-29Ca-PA 236 CG17799-PA 75..231 126..279 195 29.4 Plus
lectin-30A-PA 223 CG17011-PA 105..218 162..279 193 34.7 Plus
CG12111-PB 188 CG12111-PB 48..174 162..279 172 29.9 Plus
CG12111-PA 188 CG12111-PA 48..174 162..279 172 29.9 Plus
lectin-37Db-PB 150 CG33533-PB 30..148 164..279 168 30 Plus
lectin-37Db-PA 150 CG33533-PA 30..148 164..279 168 30 Plus
tfc-PC 188 CG9134-PC 56..184 164..279 145 24.8 Plus
tfc-PA 188 CG9134-PA 56..184 164..279 145 24.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17697-PA 153 GI17697-PA 35..149 164..279 199 31 Plus
Dmoj\GI14022-PA 161 GI14022-PA 37..157 165..281 191 31.4 Plus
Dmoj\GI24628-PA 146 GI24628-PA 28..145 164..282 186 31.1 Plus
Dmoj\GI14792-PA 194 GI14792-PA 54..180 162..279 177 31.5 Plus
Dmoj\GI24639-PA 192 GI24639-PA 75..187 164..279 153 26.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10741-PA 236 GL10741-PA 9..233 4..281 336 30.7 Plus
Dper\GL26175-PA 238 GL26175-PA 99..222 162..279 243 37.1 Plus
Dper\GL26705-PA 277 GL26705-PA 91..276 104..279 209 29.8 Plus
Dper\GL26845-PA 183 GL26845-PA 7..176 119..279 200 29.4 Plus
Dper\GL23662-PA 399 GL23662-PA 219..398 107..279 195 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24466-PA 236 GA24466-PA 1..231 1..279 330 29.4 Plus
Dpse\GA25561-PA 181 GA25561-PA 42..165 162..279 239 37.1 Plus
Dpse\GA22633-PA 411 GA22633-PA 82..232 25..235 231 29.4 Plus
Dpse\GA29021-PA 141 GA29021-PA 9..130 162..279 214 35.2 Plus
Dpse\GA29024-PA 277 GA29024-PA 91..276 104..279 212 30.5 Plus
Dpse\GA22633-PA 411 GA22633-PA 271..391 144..260 188 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18119-PA 291 GM18119-PA 1..287 1..279 1176 76.7 Plus
Dsec\GM16433-PA 283 GM16433-PA 38..278 31..279 333 31.8 Plus
Dsec\GM16582-PA 268 GM16582-PA 23..261 4..279 315 26.8 Plus
Dsec\GM18457-PA 255 GM18457-PA 65..244 98..279 284 34.8 Plus
Dsec\Acp29AB-PA 234 GM12975-PA 114..229 162..279 218 36.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22727-PA 291 GD22727-PA 1..287 1..279 1184 77.4 Plus
Dsim\GD12013-PA 358 GD12013-PA 1..353 1..279 379 30.1 Plus
Dsim\GD23470-PA 283 GD23470-PA 38..278 31..279 334 32.2 Plus
Dsim\GD22877-PA 230 GD22877-PA 9..227 31..279 315 34.5 Plus
Dsim\GD23494-PA 275 GD23494-PA 1..269 1..279 314 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16497-PA 252 GJ16497-PA 4..247 26..279 254 28.6 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 44..224 116..279 211 29.1 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 63..164 158..260 198 35.9 Plus
Dvir\GJ18255-PA 159 GJ18255-PA 36..157 162..279 195 28.7 Plus
Dvir\GJ16416-PA 164 GJ16416-PA 46..163 164..282 181 29.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24541-PA 431 GK24541-PA 9..209 11..260 268 28.4 Plus
Dwil\GK19037-PA 249 GK19037-PA 1..239 63..279 237 26.4 Plus
Dwil\GK19210-PA 164 GK19210-PA 8..164 129..282 195 27.4 Plus
Dwil\GK25689-PA 196 GK25689-PA 56..182 162..279 178 31.5 Plus
Dwil\GK18670-PA 255 GK18670-PA 133..249 161..279 178 34.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14642-PA 274 GE14642-PA 1..268 1..279 360 29.3 Plus
Dyak\GE18275-PA 358 GE18275-PA 1..353 1..279 331 26.8 Plus
Dyak\GE15323-PA 368 GE15323-PA 117..361 1..279 318 28.7 Plus
Dyak\GE14533-PA 282 GE14533-PA 41..277 34..279 314 34.9 Plus
Dyak\GE16979-PA 269 GE16979-PA 1..267 1..281 240 26 Plus

RT03147.hyp Sequence

Translation from 1 to 848

> RT03147.hyp
MFRLSVLVLNLLLVSHEFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYVA
IHQDKWNTCTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLD
RMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFS
AINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTK
QEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHH
NNDQERCVSILRKLMHVGNCTYEKRFICQYGI*

RT03147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-24A-PA 282 CG3410-PA 1..282 1..282 1488 100 Plus
lectin-24Db-PA 359 CG2958-PA 1..354 1..279 357 29.8 Plus
CG15818-PA 283 CG15818-PA 38..278 31..279 343 32.6 Plus
lectin-28C-PC 265 CG7106-PC 41..260 34..279 327 28.9 Plus
lectin-28C-PB 265 CG7106-PB 41..260 34..279 327 28.9 Plus