Clone Sequence Records
RT03201.complete Sequence
509 bp assembled on 2010-02-26
GenBank Submission: BT099969.3
> RT03201.complete
ATGAAAGTTATTATTTTGCTGGCTCTCTTCAGCCAGATTATCCTGGAAAT
TGTTGCCTATGAGCATAAAATCGCTCACAGGAAATGTGGCGAGAACACTT
TCCCAGATTGTTATTCATATTGTAACAAAGGATGCAAGGATAACCCAGTC
GACTGCATTCATTACTGCGAGAAAGGATGTGGATGCATCGAAGGCTCAAT
AGTGAGAAACAATGGAGGATGCCGAAGAATAAAGATTTGCGACAAGGATG
ATGATTCCCTATCCGTTGAAAATAACGAGTTGGCTGAAAAATACGTAACA
TCTTATTGGGAGGACCCGGTAAATAGTAATGAAAATGAAAATCAAGCCCA
AACGTTAGATGGTTTGGATGAAAACAAATCGGGTGAGATAAAAAGCATGG
AACAGCCGAATGAAGTGCCGCCGGAGAGTCCTTCGGAGGATGCTCCCAAT
GATCCCAAGCCACCAGTAGATGCAGTGTAACACTTCTATAGTGTCACCTT
AAATTCGCC
RT03201.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:35:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Sfp53D-RA | 555 | Sfp53D-RA | 20..499 | 1..480 | 2400 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:46:10
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr2R | 21145070 | chr2R | 12631827..12632306 | 480..1 | 2385 | 99.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:46:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 16744606..16745085 | 480..1 | 2400 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25260384 | 2R | 16745805..16746284 | 480..1 | 2400 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 14:46:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| copia | 5143 | copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). | 1194..1225 | 322..353 | 106 | 81.2 | Plus |
RT03201.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:10 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr2R | 12631819..12632306 | 1..488 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:10:16 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 1..480 | 1..480 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:41 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 1..480 | 1..480 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:11 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 1..480 | 1..480 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:01 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 1..480 | 1..480 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:10:11 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 20..507 | 1..488 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:41 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 20..507 | 1..488 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:11 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 20..507 | 1..488 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:01 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp53D-RA | 30..517 | 1..488 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:10 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 16744598..16745085 | 1..488 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:10 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 16744598..16745085 | 1..488 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:10 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 16744598..16745085 | 1..488 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:11 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 12632103..12632590 | 1..488 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:08 Download gff for
RT03201.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 16745797..16746284 | 1..488 | 99 | | Minus |
RT03201.pep Sequence
Translation from 0 to 479
> RT03201.pep
MKVIILLALFSQIILEIVAYEHKIAHRKCGENTFPDCYSYCNKGCKDNPV
DCIHYCEKGCGCIEGSIVRNNGGCRRIKICDKDDDSLSVENNELAEKYVT
SYWEDPVNSNENENQAQTLDGLDENKSGEIKSMEQPNEVPPESPSEDAPN
DPKPPVDAV*
RT03201.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:29:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dana\GF13453-PA | 173 | GF13453-PA | 30..119 | 2..90 | 179 | 41.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:29:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG22250-PA | 152 | GG22250-PA | 1..149 | 1..158 | 491 | 63.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Sfp53D-PB | 159 | CG42477-PB | 1..159 | 1..159 | 874 | 100 | Plus |
| Sfp53D-PA | 159 | CG42477-PA | 1..159 | 1..159 | 874 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:29:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dmoj\GI18491-PA | 122 | GI18491-PA | 10..77 | 15..80 | 155 | 39.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:29:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dper\GL11820-PA | 174 | GL11820-PA | 1..79 | 1..85 | 151 | 37.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:29:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM20038-PA | 157 | GM20038-PA | 1..157 | 1..159 | 694 | 83 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:29:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD25522-PA | 157 | GD25522-PA | 1..157 | 1..159 | 709 | 84.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:29:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE14042-PA | 154 | GE14042-PA | 1..147 | 1..153 | 520 | 64.7 | Plus |
RT03201.hyp Sequence
Translation from 1 to 479
> RT03201.hyp
MKVIILLALFSQIILEIVAYEHKIAHRKCGENTFPDCYSYCNKGCKDNPV
DCIHYCEKGCGCIEGSIVRNNGGCRRIKICDKDDDSLSVENNELAEKYVT
SYWEDPVNSNENENQAQTLDGLDENKSGEIKSMEQPNEVPPESPSEDAPN
DPKPPVDAV*
RT03201.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:37:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Sfp53D-PB | 159 | CG42477-PB | 1..159 | 1..159 | 874 | 100 | Plus |
| Sfp53D-PA | 159 | CG42477-PA | 1..159 | 1..159 | 874 | 100 | Plus |
