Clone RT03208 Report

Search the DGRC for RT03208

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:32
Well:8
Vector:pCR2.1
Associated Gene/TranscriptSfp70A4-RA
Protein status:RT03208.pep: gold
Sequenced Size:195

Clone Sequence Records

RT03208.complete Sequence

195 bp assembled on 2010-02-26

GenBank Submission: BT100096.3

> RT03208.complete
ATGAAGTTACTGAACCTACTACTGGTCGTTCTCTTCCTAATAGGAATGGT
TGAGGCTCGAAGAAGGAAAAGAGAGGTTGAAATTTGGATACGACCAGAAA
AGCACAATCCACCAGGAACCAGATATTGTTCACCTGAGGACCCCATGTGT
CAAAGATATGGTGATTAACACTTCTATAGTGTCACCTAAATTCGC

RT03208.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp70A4-RA 205 Sfp70A4-RA 5..172 1..168 840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13286937..13287104 168..1 840 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13296689..13296856 168..1 840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13289789..13289956 168..1 840 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:18:37 has no hits.

RT03208.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:19:46 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13286932..13287104 1..173 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:10:21 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 1..168 1..168 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:48 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 1..168 1..168 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:59:38 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 1..168 1..168 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:06:12 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 1..168 1..168 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:10:21 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..176 1..173 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:48 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..176 1..173 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:59:38 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..176 1..173 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:06:12 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..176 1..173 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:46 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13296684..13296856 1..173 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:46 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13296684..13296856 1..173 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:46 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13296684..13296856 1..173 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:59:38 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13289784..13289956 1..173 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:23 Download gff for RT03208.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13289784..13289956 1..173 98   Minus

RT03208.pep Sequence

Translation from 0 to 167

> RT03208.pep
MKLLNLLLVVLFLIGMVEARRRKREVEIWIRPEKHNPPGTRYCSPEDPMC
QRYGD*

RT03208.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp70A4-PB 55 CG42480-PB 1..55 1..55 298 100 Plus
Sfp70A4-PA 55 CG42480-PA 1..55 1..55 298 100 Plus

RT03208.hyp Sequence

Translation from 1 to 167

> RT03208.hyp
MKLLNLLLVVLFLIGMVEARRRKREVEIWIRPEKHNPPGTRYCSPEDPMC
QRYGD*

RT03208.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp70A4-PB 55 CG42480-PB 1..55 1..55 298 100 Plus
Sfp70A4-PA 55 CG42480-PA 1..55 1..55 298 100 Plus