RT03208.complete Sequence
195 bp assembled on 2010-02-26
GenBank Submission: BT100096.3
> RT03208.complete
ATGAAGTTACTGAACCTACTACTGGTCGTTCTCTTCCTAATAGGAATGGT
TGAGGCTCGAAGAAGGAAAAGAGAGGTTGAAATTTGGATACGACCAGAAA
AGCACAATCCACCAGGAACCAGATATTGTTCACCTGAGGACCCCATGTGT
CAAAGATATGGTGATTAACACTTCTATAGTGTCACCTAAATTCGC
RT03208.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:55:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp70A4-RA | 205 | Sfp70A4-RA | 5..172 | 1..168 | 840 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:18:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13286937..13287104 | 168..1 | 840 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:18:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13296689..13296856 | 168..1 | 840 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13289789..13289956 | 168..1 | 840 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 09:18:37 has no hits.
RT03208.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:19:46 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13286932..13287104 | 1..173 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:10:21 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 1..168 | 1..168 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:48 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 1..168 | 1..168 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:59:38 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 1..168 | 1..168 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:06:12 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 1..168 | 1..168 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:10:21 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..176 | 1..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:48 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..176 | 1..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:59:38 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..176 | 1..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:06:12 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..176 | 1..173 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:46 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13296684..13296856 | 1..173 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:46 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13296684..13296856 | 1..173 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:19:46 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13296684..13296856 | 1..173 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:59:38 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13289784..13289956 | 1..173 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:23 Download gff for
RT03208.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13289784..13289956 | 1..173 | 98 | | Minus |
RT03208.pep Sequence
Translation from 0 to 167
> RT03208.pep
MKLLNLLLVVLFLIGMVEARRRKREVEIWIRPEKHNPPGTRYCSPEDPMC
QRYGD*
RT03208.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp70A4-PB | 55 | CG42480-PB | 1..55 | 1..55 | 298 | 100 | Plus |
Sfp70A4-PA | 55 | CG42480-PA | 1..55 | 1..55 | 298 | 100 | Plus |
RT03208.hyp Sequence
Translation from 1 to 167
> RT03208.hyp
MKLLNLLLVVLFLIGMVEARRRKREVEIWIRPEKHNPPGTRYCSPEDPMC
QRYGD*
RT03208.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp70A4-PB | 55 | CG42480-PB | 1..55 | 1..55 | 298 | 100 | Plus |
Sfp70A4-PA | 55 | CG42480-PA | 1..55 | 1..55 | 298 | 100 | Plus |