Clone RT03229 Report

Search the DGRC for RT03229

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:32
Well:29
Vector:pCR2.1
Associated Gene/Transcriptobst-I-RA
Protein status:RT03229.pep: gold
Sequenced Size:681

Clone Sequence Records

RT03229.complete Sequence

681 bp assembled on 2010-03-15

GenBank Submission: BT100064.3

> RT03229.complete
ATGGATTCATCTCGCCTGATTATCTGCCTCCTAACTTTTCTGTTGTTTCA
AACGGGAAAAGGGTTGGGGAACGGCAGTTATCTGGAGCTCAGATTGGATG
CAGCTGCTGAATCCTGTCCAGATGATTACTACTTTAACGAAACTATCCAA
GCCTGCGTATCTACAGACACTACCAGCTGTACCAATCACCAAATCGGCAA
ATGTCCGATGGCCACAGAAATGGACGAGTTTTGCGTGTGCAAAGATAAGC
ACCTTCAGATCTGGAAATGCCCTGAAGGAACCTACTTCGATGCCAACCGA
TTGGTCTGCCGGGTGGGAAGCGTTGAGTGCCAGGACGATTATACTCCATC
CCCATGTCCTAACAGCACGGCAAGCGATGTCTTCTGCCTCTGCATCGATG
GCAAATGGCATCTTAACTACTGTCCAACGGGCTTTACCTTTGATGACGAG
CTGCAGATTTGCCTGAACACAGGATCTGATGACGACGAGTTGCCCAGTTC
GTCTGGAAAGTGCCAGCGGCTTGGATTGTTTGGTGATCCCGCTGACTGCT
CTGGGTACTATCATTGTCGCGAAAAGGGCAGTGATATTGAGTATTTCAGA
TGCTCGGTAGGAACCATCTTCAATCTAATTTCCTTTGCGTGCGTTACTGG
AACTTGTTGACACTTCTATAGTGTCACCTAA

RT03229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
obst-I-RA 660 obst-I-RA 1..660 1..660 3300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2267276..2267936 1..661 3305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2267870..2268530 1..661 3305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2267870..2268530 1..661 3305 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:46:11 has no hits.

RT03229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:11 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2267276..2267944 1..670 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-15 17:56:13 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:57 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:14 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:04 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-15 17:56:11 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:57 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:14 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:04 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
obst-I-RA 13..681 1..670 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:11 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2267870..2268538 1..670 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:11 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2267870..2268538 1..670 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:11 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2267870..2268538 1..670 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:14 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2267870..2268538 1..670 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:52 Download gff for RT03229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2267870..2268538 1..670 99   Plus

RT03229.pep Sequence

Translation from 0 to 659

> RT03229.pep
MDSSRLIICLLTFLLFQTGKGLGNGSYLELRLDAAAESCPDDYYFNETIQ
ACVSTDTTSCTNHQIGKCPMATEMDEFCVCKDKHLQIWKCPEGTYFDANR
LVCRVGSVECQDDYTPSPCPNSTASDVFCLCIDGKWHLNYCPTGFTFDDE
LQICLNTGSDDDELPSSSGKCQRLGLFGDPADCSGYYHCREKGSDIEYFR
CSVGTIFNLISFACVTGTC*

RT03229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24909-PA 217 GF24909-PA 9..217 6..219 531 48.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14853-PA 217 GG14853-PA 1..217 1..219 837 72.1 Plus
Dere\GG14854-PA 313 GG14854-PA 207..307 54..154 152 29.7 Plus
Dere\GG14854-PA 313 GG14854-PA 242..313 38..109 147 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16472-PA 136 GH16472-PA 47..136 131..219 168 41.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
obst-I-PA 219 CG32304-PA 1..219 1..219 1232 100 Plus
CG32302-PA 313 CG32302-PA 195..308 38..154 177 31.6 Plus
CG17826-PA 751 CG17826-PA 109..286 38..215 153 25.4 Plus
CG43896-PB 1324 CG43896-PB 178..382 33..208 148 24.5 Plus
CG43896-PD 2113 CG43896-PD 178..382 33..208 148 24.5 Plus
CG43896-PC 2113 CG43896-PC 178..382 33..208 148 24.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12145-PA 130 GI12145-PA 38..130 128..219 172 38.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24645-PA 344 GL24645-PA 225..344 59..219 214 33.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16817-PA 344 GA16817-PA 225..344 59..219 211 33.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14479-PA 219 GM14479-PA 1..219 1..219 1061 90.9 Plus
Dsec\GM14480-PA 312 GM14480-PA 207..307 54..154 156 31.7 Plus
Dsec\GM14480-PA 312 GM14480-PA 242..311 38..107 144 37.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13675-PA 219 GD13675-PA 1..219 1..219 1061 90.9 Plus
Dsim\GD13676-PA 312 GD13676-PA 207..307 54..154 157 30.7 Plus
Dsim\GD13676-PA 312 GD13676-PA 242..311 38..107 146 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13423-PA 135 GJ13423-PA 45..135 131..219 172 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20310-PA 202 GE20310-PA 2..202 19..219 886 79.6 Plus
Dyak\GE20311-PA 313 GE20311-PA 207..307 54..154 155 30.7 Plus
Dyak\GE20311-PA 313 GE20311-PA 242..313 38..109 153 36.1 Plus

RT03229.hyp Sequence

Translation from 1 to 659

> RT03229.hyp
MDSSRLIICLLTFLLFQTGKGLGNGSYLELRLDAAAESCPDDYYFNETIQ
ACVSTDTTSCTNHQIGKCPMATEMDEFCVCKDKHLQIWKCPEGTYFDANR
LVCRVGSVECQDDYTPSPCPNSTASDVFCLCIDGKWHLNYCPTGFTFDDE
LQICLNTGSDDDELPSSSGKCQRLGLFGDPADCSGYYHCREKGSDIEYFR
CSVGTIFNLISFACVTGTC*

RT03229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
obst-I-PA 219 CG32304-PA 1..219 1..219 1232 100 Plus
CG32302-PA 313 CG32302-PA 195..308 38..154 177 31.6 Plus
CG17826-PA 751 CG17826-PA 109..286 38..215 153 25.4 Plus
CG43896-PB 1324 CG43896-PB 178..382 33..208 148 24.5 Plus
CG43896-PD 2113 CG43896-PD 178..382 33..208 148 24.5 Plus