Clone RT03304 Report

Search the DGRC for RT03304

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:33
Well:4
Vector:pCR2.1
Associated Gene/TranscriptCpr30B-RA
Protein status:RT03304.pep: gold
Sequenced Size:462

Clone Sequence Records

RT03304.complete Sequence

462 bp assembled on 2010-06-21

GenBank Submission: BT100143.4

> RT03304.complete
ATGATGGGAAAAGTTACCTATTTGTTGTGCCTGTGCCTGGCCAGCGCCGT
TTGGGCCATTGAATTGCAGGCGGAGCCGGACTACGGACCAGTGGCCTACG
AGTTCCAGTGGTCGGTGAACGATCCCCACACCGGCGACATCAAGAGCCAA
AAGGAGTCCCGCAAGGACGACAAGGTCGAGGGTGTCTACGAGCTGATCGA
TTCCGATGGCTATCGCCGCATAGTGCAGTACAAGGCGGATGATCACAACG
GTTTCGAGGCAATTGTCCAGCGTGAGCCCACGGACATCAAGATACCGTTG
CCTGAGCCACCCAAGAAGCTCCTGGCCGCCAAGATCCTGACTCCCGTGCT
ACCGGTGGCGCCACTCGTCCACTACGCCGCCCCCAAGGCCATTATCAAGC
AGGAGCTGTCCGCCGGGAACTATGTCTCTGTATCCGGACCAACAGCACAG
TACAAGTACTAA

RT03304.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr30B-RA 850 Cpr30B-RA 197..658 1..462 2310 100 Plus
Cpr30F-RA 787 Cpr30F-RA 369..497 127..255 240 79 Plus
Cpr30F.b 912 Cpr30F.b 239..367 127..255 240 79 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9541867..9542314 13..460 2225 99.8 Plus
chr2L 23010047 chr2L 9931651..9931779 255..127 240 79.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9543029..9543478 13..462 2250 100 Plus
2L 23513712 2L 9932737..9932865 255..127 240 79.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9543029..9543478 13..462 2250 100 Plus
2L 23513712 2L 9932737..9932865 255..127 240 79 Minus
Blast to na_te.dros performed on 2019-03-16 04:29:25 has no hits.

RT03304.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:30:16 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9541867..9542316 13..462 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2011-03-16 13:21:34 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 1..460 1..460 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:08 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 1..462 1..462 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:08 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 1..462 1..462 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:40:55 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 1..462 1..462 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-21 18:05:21 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 1..460 1..460 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:08 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 70..531 1..462 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:08 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 70..531 1..462 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:40:55 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30B-RA 70..531 1..462 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:16 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9543029..9543478 13..462 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:16 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9543029..9543478 13..462 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:16 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9543029..9543478 13..462 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:08 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9543029..9543478 13..462 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:38 Download gff for RT03304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9543029..9543478 13..462 100   Plus

RT03304.pep Sequence

Translation from 0 to 461

> RT03304.pep
MMGKVTYLLCLCLASAVWAIELQAEPDYGPVAYEFQWSVNDPHTGDIKSQ
KESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPL
PEPPKKLLAAKILTPVLPVAPLVHYAAPKAIIKQELSAGNYVSVSGPTAQ
YKY*

RT03304.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22765-PA 153 GF22765-PA 1..153 1..153 737 89.5 Plus
Dana\GF14150-PA 146 GF14150-PA 44..124 29..109 242 55.6 Plus
Dana\GF17184-PA 186 GF17184-PA 37..97 33..93 200 59 Plus
Dana\GF23877-PA 204 GF23877-PA 73..132 33..92 198 56.7 Plus
Dana\GF15729-PA 102 GF15729-PA 10..102 9..96 197 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25358-PA 155 GG25358-PA 1..155 1..153 778 96.1 Plus
Dere\GG23995-PA 146 GG23995-PA 42..110 30..98 230 59.4 Plus
Dere\GG13610-PA 183 GG13610-PA 37..160 33..143 215 42.4 Plus
Dere\GG24256-PA 199 GG24256-PA 68..128 33..93 195 57.4 Plus
Dere\GG10068-PA 106 GG10068-PA 19..102 13..93 190 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10431-PA 150 GH10431-PA 1..150 2..153 531 70.8 Plus
Dgri\GH10434-PA 139 GH10434-PA 43..112 29..98 241 60 Plus
Dgri\GH18129-PA 227 GH18129-PA 57..185 33..151 212 43.1 Plus
Dgri\GH18128-PA 166 GH18128-PA 67..163 33..131 208 49.5 Plus
Dgri\GH11305-PA 105 GH11305-PA 1..101 2..96 205 46.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr30B-PA 153 CG3818-PA 1..153 1..153 804 100 Plus
Cpr30F-PA 146 CG31876-PA 42..145 30..141 256 50 Plus
Ccp84Aa-PA 205 CG2360-PA 48..183 20..143 224 40.6 Plus
Ccp84Ab-PA 221 CG1252-PA 48..183 20..143 219 39.9 Plus
Ccp84Ad-PA 199 CG2341-PA 51..199 23..153 216 36.7 Plus
Edg84A-PA 188 CG2345-PA 37..165 33..143 215 41.5 Plus
CG34461-PB 138 CG34461-PB 35..137 13..125 210 45.2 Plus
CG34461-PA 138 CG34461-PA 35..137 13..125 210 45.2 Plus
Ccp84Ag-PA 191 CG2342-PA 1..145 1..130 199 38.6 Plus
Cpr64Aa-PA 192 CG15006-PA 60..140 33..124 198 46.7 Plus
CG42367-PC 103 CG42367-PC 9..99 8..93 192 47.3 Plus
Cpr31A-PA 340 CG33302-PA 127..230 20..128 192 39.4 Plus
Cpr76Bb-PA 198 CG9290-PA 79..144 25..91 191 55.2 Plus
Cpr64Ad-PB 247 CG1259-PB 146..243 33..138 190 44.3 Plus
Ccp84Af-PA 151 CG1331-PA 51..142 23..128 188 43.9 Plus
Cpr92A-PA 245 CG6240-PA 68..171 33..125 187 39.4 Plus
Cpr5C-PA 145 CG4052-PA 53..142 23..127 186 42.5 Plus
Cpr66Cb-PA 162 CG7076-PA 84..147 28..91 186 53.1 Plus
Ccp84Ae-PA 208 CG1330-PA 36..150 13..133 186 40.2 Plus
Cpr35B-PA 218 CG3474-PA 72..131 33..92 186 60 Plus
Cpr23B-PA 302 CG2973-PA 148..221 25..97 184 50 Plus
Ccp84Ac-PA 217 CG1327-PA 58..181 26..150 181 38.5 Plus
Cpr62Bc-PB 180 CG1919-PB 54..160 33..130 177 39.3 Plus
Cpr62Bc-PA 180 CG1919-PA 54..160 33..130 177 39.3 Plus
Cpr66D-PA 270 CG32029-PA 157..237 32..110 176 45.7 Plus
Cpr64Ab-PA 120 CG15007-PA 5..119 4..117 174 38.2 Plus
Cpr76Ba-PA 204 CG9283-PA 93..157 25..90 173 53 Plus
Crys-PB 477 CG16963-PB 77..139 33..95 162 52.4 Plus
Crys-PA 477 CG16963-PA 77..139 33..95 162 52.4 Plus
Cpr76Bc-PD 424 CG9295-PD 45..127 22..105 157 41.7 Plus
Cpr76Bc-PC 424 CG9295-PC 45..127 22..105 157 41.7 Plus
Cpr76Bd-PD 1228 CG9299-PD 1153..1209 33..89 156 54.4 Plus
Cpr76Bd-PB 1228 CG9299-PB 1153..1209 33..89 156 54.4 Plus
Cpr76Bd-PC 1231 CG9299-PC 1156..1212 33..89 156 54.4 Plus
Cpr62Bb-PC 194 CG13935-PC 4..123 7..131 149 30 Plus
Cpr62Bb-PB 194 CG13935-PB 4..123 7..131 149 30 Plus
Cpr62Bb-PA 194 CG13935-PA 4..123 7..131 149 30 Plus
CG13670-PA 266 CG13670-PA 103..159 33..89 144 47.4 Plus
Cpr64Ac-PA 188 CG15008-PA 71..174 13..116 140 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24282-PA 151 GI24282-PA 1..151 2..153 538 71.2 Plus
Dmoj\GI24313-PA 146 GI24313-PA 43..145 29..141 270 53.1 Plus
Dmoj\GI17588-PA 331 GI17588-PA 104..193 13..107 201 46.3 Plus
Dmoj\GI17648-PA 242 GI17648-PA 83..142 33..92 200 60 Plus
Dmoj\GI17726-PA 103 GI17726-PA 1..99 2..96 194 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18914-PA 149 GL18914-PA 1..149 1..153 655 83.1 Plus
Dper\GL19198-PA 146 GL19198-PA 38..145 19..141 256 48 Plus
Dper\GL24692-PA 133 GL24692-PA 27..132 10..125 209 41.9 Plus
Dper\GL18957-PA 316 GL18957-PA 103..178 13..93 201 48.1 Plus
Dper\GL25767-PA 214 GL25767-PA 65..125 33..93 197 57.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25856-PA 149 GA25856-PA 1..149 1..153 655 83.1 Plus
Dpse\GA16543-PA 146 GA16543-PA 38..145 19..141 256 48 Plus
Dpse\GA23954-PA 133 GA23954-PA 27..132 10..125 209 41.9 Plus
Dpse\GA25870-PA 316 GA25870-PA 103..178 13..93 202 48.1 Plus
Dpse\GA17469-PA 216 GA17469-PA 65..125 33..93 197 57.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17521-PA 153 GM17521-PA 1..153 1..153 799 99.3 Plus
Dsec\GM12125-PA 146 GM12125-PA 42..110 30..98 231 58 Plus
Dsec\GM10909-PA 188 GM10909-PA 37..165 33..143 215 41.5 Plus
Dsec\GM13999-PA 195 GM13999-PA 60..119 33..92 193 55 Plus
Dsec\GM17810-PA 101 GM17810-PA 13..97 12..93 187 48.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23612-PA 153 GD23612-PA 1..153 1..153 799 99.3 Plus
Dsim\GD22323-PA 146 GD22323-PA 42..110 30..98 231 58 Plus
Dsim\GD19888-PA 188 GD19888-PA 37..165 33..143 215 41.5 Plus
Dsim\GD14078-PA 177 GD14078-PA 73..176 12..125 205 43.1 Plus
Dsim\GD19526-PA 236 GD19526-PA 62..183 33..143 201 41.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21540-PA 153 GJ21540-PA 1..153 1..153 553 73.2 Plus
Dvir\GJ21574-PA 146 GJ21574-PA 43..145 29..141 265 52.2 Plus
Dvir\GJ17932-PA 343 GJ17932-PA 109..184 13..93 210 51.9 Plus
Dvir\GJ12961-PA 135 GJ12961-PA 36..134 17..125 208 44.5 Plus
Dvir\GJ23298-PA 181 GJ23298-PA 40..156 33..143 203 41.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24775-PA 155 GK24775-PA 1..155 2..153 668 83.9 Plus
Dwil\GK24776-PA 148 GK24776-PA 43..122 29..108 239 55 Plus
Dwil\GK10832-PA 179 GK10832-PA 55..179 33..153 221 40.5 Plus
Dwil\GK12249-PA 228 GK12249-PA 55..175 33..151 210 41.9 Plus
Dwil\GK18086-PA 213 GK18086-PA 69..129 33..93 203 59 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18851-PA 155 GE18851-PA 1..155 1..153 784 97.4 Plus
Dyak\GE10171-PA 146 GE10171-PA 42..110 30..98 229 59.4 Plus
Dyak\GE24878-PA 188 GE24878-PA 1..165 1..143 217 33.3 Plus
Dyak\GE20636-PA 195 GE20636-PA 60..119 33..92 195 55 Plus
Dyak\GE18882-PA 106 GE18882-PA 19..102 13..93 192 50 Plus

RT03304.hyp Sequence

Translation from 1 to 459

> RT03304.hyp
MMGKVTYLLCLCLASAVWAIELQAEPDYGPVAYEFQWSVNDPHTGDIKSQ
KESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPL
PEPPKKLLAAKILTPVLPVAPLVHYAAPKAIIKQELSAGNYVSVSGPTAQ
YKY

RT03304.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr30B-PA 153 CG3818-PA 1..153 1..153 804 100 Plus
Cpr30F-PA 146 CG31876-PA 42..145 30..141 256 50 Plus
Ccp84Aa-PA 205 CG2360-PA 48..183 20..143 224 40.6 Plus
Ccp84Ab-PA 221 CG1252-PA 48..183 20..143 219 39.9 Plus
Ccp84Ad-PA 199 CG2341-PA 51..199 23..153 216 36.7 Plus