RT03314.complete Sequence
403 bp assembled on 2010-02-26
GenBank Submission: BT100150.3
> RT03314.complete
GTTGTAATAAAAATGCGGTATCTGTGCGTTTTTTCCTTAACACTTATCCT
TTGCTGCCTTTCAATAAAGGCTCAGAGCTTAAATTGCACCAGGCTTCGAG
AAAATTGTCGTCCTTGCACCCGCCGCTTGGTGGATCCTATTAACGACCTG
GAATTCATTAATAGCGATTGTAGGGAGAAACTTAGAGGACGTTGGATTTG
GCGGGATGTAAGGCGTTGTGATATGCAAATTGTTGCGTGCGAAAATCATG
AAACCCGACTGGATTGCGAGAATGTGGCTAGACTAACAGGCATGAGACGG
ATTCGTTGATTTTTCTTAGCTCTTGAGAGAAATTTAAAGCTATTTGTCTT
TTTAAACAATATTTTTAGACATAAATAAAGAATTATGTGTGTACGAGCAA
TGT
RT03314.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:35:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ej-RA | 418 | Eig71Ej-RA | 11..413 | 1..403 | 2015 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:55:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 15650674..15650917 | 244..1 | 1220 | 100 | Minus |
chr3L | 24539361 | chr3L | 15650451..15650609 | 403..245 | 795 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:55:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15660772..15661015 | 244..1 | 1220 | 100 | Minus |
3L | 28110227 | 3L | 15660549..15660707 | 403..245 | 795 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 15653872..15654115 | 244..1 | 1220 | 100 | Minus |
3L | 28103327 | 3L | 15653649..15653807 | 403..245 | 795 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 19:55:19 has no hits.
RT03314.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:56:13 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 15650451..15650609 | 245..403 | 100 | <- | Minus |
chr3L | 15650674..15650917 | 1..244 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:10:26 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..297 | 13..309 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:55 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..297 | 13..309 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:16:35 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..297 | 13..309 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:24 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..297 | 13..309 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:10:25 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..403 | 1..403 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:55 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..403 | 1..403 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:16:35 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..403 | 1..403 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:24 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ej-RA | 1..403 | 1..403 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:13 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15660549..15660707 | 245..403 | 100 | <- | Minus |
3L | 15660772..15661015 | 1..244 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:13 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15660549..15660707 | 245..403 | 100 | <- | Minus |
3L | 15660772..15661015 | 1..244 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:13 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15660549..15660707 | 245..403 | 100 | <- | Minus |
3L | 15660772..15661015 | 1..244 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:16:35 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15653649..15653807 | 245..403 | 100 | <- | Minus |
arm_3L | 15653872..15654115 | 1..244 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:21 Download gff for
RT03314.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15653872..15654115 | 1..244 | 100 | | Minus |
3L | 15653649..15653807 | 245..403 | 100 | <- | Minus |
RT03314.hyp Sequence
Translation from 0 to 308
> RT03314.hyp
VVIKMRYLCVFSLTLILCCLSIKAQSLNCTRLRENCRPCTRRLVDPINDL
EFINSDCREKLRGRWIWRDVRRCDMQIVACENHETRLDCENVARLTGMRR
IR*
RT03314.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ej-PA | 98 | CG7588-PA | 1..98 | 5..102 | 536 | 100 | Plus |
Eig71Ef-PA | 98 | CG7599-PA | 1..96 | 5..100 | 272 | 47.9 | Plus |
Eig71Eh-PB | 101 | CG7594-PB | 9..95 | 15..101 | 194 | 35.6 | Plus |
Eig71Ed-PA | 99 | CG7350-PA | 1..98 | 5..101 | 163 | 32.7 | Plus |
Eig71Ea-PA | 100 | CG16931-PA | 1..99 | 5..102 | 159 | 31.3 | Plus |
RT03314.pep Sequence
Translation from 0 to 308
> RT03314.pep
VVIKMRYLCVFSLTLILCCLSIKAQSLNCTRLRENCRPCTRRLVDPINDL
EFINSDCREKLRGRWIWRDVRRCDMQIVACENHETRLDCENVARLTGMRR
IR*
RT03314.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:45:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10380-PA | 101 | GF10380-PA | 1..98 | 5..102 | 375 | 74.5 | Plus |
Dana\GF10381-PA | 99 | GF10381-PA | 1..96 | 5..100 | 256 | 45.8 | Plus |
Dana\GF10385-PA | 102 | GF10385-PA | 1..100 | 5..100 | 144 | 34 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:45:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13527-PA | 98 | GG13527-PA | 1..96 | 5..100 | 257 | 46.9 | Plus |
Dere\GG13526-PA | 101 | GG13526-PA | 9..95 | 15..101 | 182 | 35.6 | Plus |
Dere\GG13530-PA | 100 | GG13530-PA | 6..99 | 10..102 | 160 | 33 | Plus |
Dere\GG15918-PA | 99 | GG15918-PA | 1..98 | 5..101 | 137 | 30.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ej-PA | 98 | CG7588-PA | 1..98 | 5..102 | 536 | 100 | Plus |
Eig71Ef-PA | 98 | CG7599-PA | 1..96 | 5..100 | 272 | 47.9 | Plus |
Eig71Eh-PB | 101 | CG7594-PB | 9..95 | 15..101 | 194 | 35.6 | Plus |
Eig71Ed-PA | 99 | CG7350-PA | 1..98 | 5..101 | 163 | 32.7 | Plus |
Eig71Ea-PA | 100 | CG16931-PA | 1..99 | 5..102 | 159 | 31.3 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25491-PA | 98 | GL25491-PA | 1..96 | 5..100 | 244 | 49 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA20470-PA | 98 | GA20470-PA | 1..96 | 5..100 | 244 | 50 | Plus |
Dpse\GA20285-PA | 100 | GA20285-PA | 6..99 | 10..102 | 161 | 36.2 | Plus |
Dpse\GA23630-PA | 214 | GA23630-PA | 124..213 | 16..102 | 133 | 32.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24470-PA | 98 | GM24470-PA | 1..98 | 5..102 | 490 | 98 | Plus |
Dsec\GM24471-PA | 98 | GM24471-PA | 1..96 | 5..100 | 231 | 43.8 | Plus |
Dsec\GM24474-PA | 100 | GM24474-PA | 1..99 | 5..102 | 143 | 30.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12543-PA | 98 | GD12543-PA | 1..98 | 5..102 | 490 | 98 | Plus |
Dsim\GD12545-PA | 98 | GD12545-PA | 1..96 | 5..100 | 246 | 45.8 | Plus |
Dsim\GD12544-PA | 101 | GD12544-PA | 9..95 | 15..101 | 165 | 34.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:45:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11358-PA | 96 | GJ11358-PA | 21..91 | 24..98 | 154 | 41.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:45:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK20696-PA | 102 | GK20696-PA | 10..99 | 13..102 | 281 | 60 | Plus |
Dwil\GK20707-PA | 100 | GK20707-PA | 1..98 | 5..100 | 209 | 43.9 | Plus |
Dwil\GK15124-PA | 144 | GK15124-PA | 1..97 | 5..100 | 165 | 36.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:45:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22827-PA | 98 | GE22827-PA | 1..98 | 5..102 | 466 | 90.8 | Plus |
Dyak\GE19819-PA | 98 | GE19819-PA | 1..98 | 5..102 | 462 | 89.8 | Plus |
Dyak\GE22830-PA | 98 | GE22830-PA | 1..96 | 5..100 | 265 | 49 | Plus |
Dyak\GE19821-PA | 98 | GE19821-PA | 1..96 | 5..100 | 262 | 46.9 | Plus |
Dyak\GE22828-PA | 101 | GE22828-PA | 9..95 | 15..101 | 186 | 37.9 | Plus |