Clone RT03314 Report

Search the DGRC for RT03314

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:33
Well:14
Vector:pCR2.1
Associated Gene/TranscriptEig71Ej-RA
Protein status:RT03314.pep: gold
Sequenced Size:403

Clone Sequence Records

RT03314.complete Sequence

403 bp assembled on 2010-02-26

GenBank Submission: BT100150.3

> RT03314.complete
GTTGTAATAAAAATGCGGTATCTGTGCGTTTTTTCCTTAACACTTATCCT
TTGCTGCCTTTCAATAAAGGCTCAGAGCTTAAATTGCACCAGGCTTCGAG
AAAATTGTCGTCCTTGCACCCGCCGCTTGGTGGATCCTATTAACGACCTG
GAATTCATTAATAGCGATTGTAGGGAGAAACTTAGAGGACGTTGGATTTG
GCGGGATGTAAGGCGTTGTGATATGCAAATTGTTGCGTGCGAAAATCATG
AAACCCGACTGGATTGCGAGAATGTGGCTAGACTAACAGGCATGAGACGG
ATTCGTTGATTTTTCTTAGCTCTTGAGAGAAATTTAAAGCTATTTGTCTT
TTTAAACAATATTTTTAGACATAAATAAAGAATTATGTGTGTACGAGCAA
TGT

RT03314.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ej-RA 418 Eig71Ej-RA 11..413 1..403 2015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15650674..15650917 244..1 1220 100 Minus
chr3L 24539361 chr3L 15650451..15650609 403..245 795 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15660772..15661015 244..1 1220 100 Minus
3L 28110227 3L 15660549..15660707 403..245 795 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15653872..15654115 244..1 1220 100 Minus
3L 28103327 3L 15653649..15653807 403..245 795 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:55:19 has no hits.

RT03314.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:56:13 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15650451..15650609 245..403 100 <- Minus
chr3L 15650674..15650917 1..244 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:10:26 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..297 13..309 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:55 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..297 13..309 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:16:35 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..297 13..309 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:24 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..297 13..309 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:10:25 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..403 1..403 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:55 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..403 1..403 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:16:35 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..403 1..403 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:24 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ej-RA 1..403 1..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:13 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15660549..15660707 245..403 100 <- Minus
3L 15660772..15661015 1..244 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:13 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15660549..15660707 245..403 100 <- Minus
3L 15660772..15661015 1..244 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:13 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15660549..15660707 245..403 100 <- Minus
3L 15660772..15661015 1..244 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:16:35 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15653649..15653807 245..403 100 <- Minus
arm_3L 15653872..15654115 1..244 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:21 Download gff for RT03314.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15653872..15654115 1..244 100   Minus
3L 15653649..15653807 245..403 100 <- Minus

RT03314.hyp Sequence

Translation from 0 to 308

> RT03314.hyp
VVIKMRYLCVFSLTLILCCLSIKAQSLNCTRLRENCRPCTRRLVDPINDL
EFINSDCREKLRGRWIWRDVRRCDMQIVACENHETRLDCENVARLTGMRR
IR*

RT03314.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ej-PA 98 CG7588-PA 1..98 5..102 536 100 Plus
Eig71Ef-PA 98 CG7599-PA 1..96 5..100 272 47.9 Plus
Eig71Eh-PB 101 CG7594-PB 9..95 15..101 194 35.6 Plus
Eig71Ed-PA 99 CG7350-PA 1..98 5..101 163 32.7 Plus
Eig71Ea-PA 100 CG16931-PA 1..99 5..102 159 31.3 Plus

RT03314.pep Sequence

Translation from 0 to 308

> RT03314.pep
VVIKMRYLCVFSLTLILCCLSIKAQSLNCTRLRENCRPCTRRLVDPINDL
EFINSDCREKLRGRWIWRDVRRCDMQIVACENHETRLDCENVARLTGMRR
IR*

RT03314.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10380-PA 101 GF10380-PA 1..98 5..102 375 74.5 Plus
Dana\GF10381-PA 99 GF10381-PA 1..96 5..100 256 45.8 Plus
Dana\GF10385-PA 102 GF10385-PA 1..100 5..100 144 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13527-PA 98 GG13527-PA 1..96 5..100 257 46.9 Plus
Dere\GG13526-PA 101 GG13526-PA 9..95 15..101 182 35.6 Plus
Dere\GG13530-PA 100 GG13530-PA 6..99 10..102 160 33 Plus
Dere\GG15918-PA 99 GG15918-PA 1..98 5..101 137 30.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ej-PA 98 CG7588-PA 1..98 5..102 536 100 Plus
Eig71Ef-PA 98 CG7599-PA 1..96 5..100 272 47.9 Plus
Eig71Eh-PB 101 CG7594-PB 9..95 15..101 194 35.6 Plus
Eig71Ed-PA 99 CG7350-PA 1..98 5..101 163 32.7 Plus
Eig71Ea-PA 100 CG16931-PA 1..99 5..102 159 31.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25491-PA 98 GL25491-PA 1..96 5..100 244 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20470-PA 98 GA20470-PA 1..96 5..100 244 50 Plus
Dpse\GA20285-PA 100 GA20285-PA 6..99 10..102 161 36.2 Plus
Dpse\GA23630-PA 214 GA23630-PA 124..213 16..102 133 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24470-PA 98 GM24470-PA 1..98 5..102 490 98 Plus
Dsec\GM24471-PA 98 GM24471-PA 1..96 5..100 231 43.8 Plus
Dsec\GM24474-PA 100 GM24474-PA 1..99 5..102 143 30.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12543-PA 98 GD12543-PA 1..98 5..102 490 98 Plus
Dsim\GD12545-PA 98 GD12545-PA 1..96 5..100 246 45.8 Plus
Dsim\GD12544-PA 101 GD12544-PA 9..95 15..101 165 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11358-PA 96 GJ11358-PA 21..91 24..98 154 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20696-PA 102 GK20696-PA 10..99 13..102 281 60 Plus
Dwil\GK20707-PA 100 GK20707-PA 1..98 5..100 209 43.9 Plus
Dwil\GK15124-PA 144 GK15124-PA 1..97 5..100 165 36.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22827-PA 98 GE22827-PA 1..98 5..102 466 90.8 Plus
Dyak\GE19819-PA 98 GE19819-PA 1..98 5..102 462 89.8 Plus
Dyak\GE22830-PA 98 GE22830-PA 1..96 5..100 265 49 Plus
Dyak\GE19821-PA 98 GE19821-PA 1..96 5..100 262 46.9 Plus
Dyak\GE22828-PA 101 GE22828-PA 9..95 15..101 186 37.9 Plus