Clone RT03410 Report

Search the DGRC for RT03410

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:34
Well:10
Vector:pCR2.1
Associated Gene/TranscriptCpr78Ca-RA
Protein status:RT03410.pep: gold
Sequenced Size:384

Clone Sequence Records

RT03410.complete Sequence

384 bp assembled on 2010-06-21

GenBank Submission: BT100148.4

> RT03410.complete
ATGATGTCGTTCGGCAAGATTGTGGTATTCCTGGTCCTAGTCCTAGTTCA
ACTAATCCATTGTACGCGCTTTACTGCGCCATCTTTGGACAGGACCATCT
ACTACCGGAATACGCCACCCGATCCCTTCGGTCACTACAGCTTCGAGTTC
CAGACCACCAACGGCATTACCACCAAGGGAGCTGGTAATGAGAACGGAGC
CGTCGGAGTGGTTCAGTTCGTTTCTCCCGAGGGTATACCCGTTACCTTCT
CGTACGTGGCCGATGCCAATGGATATCAGCCCACCGGAGATCACATTCCC
GCCATCCCGCTGCACGTTATCCGCCAGTTGGAGTACATCCGCACGCATCC
ACCGGTGGATGAGATTCGGTCCAGACGTTGGTAA

RT03410.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78Ca-RA 971 Cpr78Ca-RA 456..839 1..384 1920 100 Plus
Cpr78Ca.a 1325 Cpr78Ca.a 456..839 1..384 1920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21281229..21281594 382..17 1830 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21292219..21292586 384..17 1840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21285319..21285686 384..17 1840 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:55:19 has no hits.

RT03410.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:56:25 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21281227..21281592 19..384 100 <- Minus
chr3L 21281658..21281675 1..18 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-21 18:05:27 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:10 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 1..384 1..384 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:53:06 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 1..384 1..384 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:15:31 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 1..384 1..384 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-21 18:05:23 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:10 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 1..384 1..384 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:53:06 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 134..517 1..384 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:15:31 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Ca-RA 134..517 1..384 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:25 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21292219..21292584 19..384 100 <- Minus
3L 21292650..21292667 1..18 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:25 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21292219..21292584 19..384 100 <- Minus
3L 21292650..21292667 1..18 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:25 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21292219..21292584 19..384 100 <- Minus
3L 21292650..21292667 1..18 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:53:06 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21285319..21285684 19..384 100 <- Minus
arm_3L 21285750..21285767 1..18 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:45 Download gff for RT03410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21285319..21285684 19..384 100 <- Minus
3L 21285750..21285767 1..18 100   Minus

RT03410.pep Sequence

Translation from 0 to 383

> RT03410.pep
MMSFGKIVVFLVLVLVQLIHCTRFTAPSLDRTIYYRNTPPDPFGHYSFEF
QTTNGITTKGAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQPTGDHIP
AIPLHVIRQLEYIRTHPPVDEIRSRRW*

RT03410.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24203-PA 115 GF24203-PA 1..115 13..127 481 80 Plus
Dana\GF24202-PA 115 GF24202-PA 1..109 9..118 214 39.5 Plus
Dana\GF10274-PA 119 GF10274-PA 37..117 41..118 214 49.4 Plus
Dana\GF10617-PA 121 GF10617-PA 3..114 6..117 190 37.1 Plus
Dana\GF14955-PA 175 GF14955-PA 31..108 41..117 180 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13246-PA 126 GG13246-PA 1..126 2..127 541 88.9 Plus
Dere\GG13245-PA 121 GG13245-PA 1..115 9..119 244 42.6 Plus
Dere\GG16171-PA 119 GG16171-PA 34..115 38..116 230 51.2 Plus
Dere\GG15459-PA 122 GG15459-PA 3..114 6..117 194 39.7 Plus
Dere\GG15456-PA 134 GG15456-PA 38..126 42..126 184 44.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16515-PA 110 GH16515-PA 1..110 14..127 365 63.2 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..117 9..121 238 40.2 Plus
Dgri\GH15299-PA 118 GH15299-PA 3..115 6..117 217 37.4 Plus
Dgri\GH13277-PA 153 GH13277-PA 23..116 27..117 214 44.7 Plus
Dgri\GH14974-PA 137 GH14974-PA 42..126 35..116 184 40 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78Ca-PA 127 CG11310-PA 1..127 1..127 680 100 Plus
Edg78E-PB 122 CG7673-PB 28..114 35..118 239 49.4 Plus
Edg78E-PA 122 CG7673-PA 28..114 35..118 239 49.4 Plus
Cpr78Cc-PA 119 CG7658-PA 35..117 39..118 237 50.6 Plus
Cpr67Fa2-PA 134 CG18349-PA 38..126 42..126 187 47.2 Plus
Cpr67Fa1-PA 134 CG7941-PA 38..126 42..126 187 47.2 Plus
Cpr67Fb-PA 122 CG18348-PA 6..114 12..117 182 37.3 Plus
Cpr78Cb-PB 140 CG7663-PB 44..128 35..116 182 38.8 Plus
Cpr78Cb-PA 140 CG7663-PA 44..128 35..116 182 38.8 Plus
Pcp-PA 184 CG3440-PA 4..117 7..117 182 36.8 Plus
Cpr65Ec-PA 127 CG8634-PA 5..116 10..117 170 36.4 Plus
Cpr49Aa-PB 144 CG30045-PB 8..130 8..118 164 35 Plus
Cpr65Eb-PA 179 CG8638-PA 44..124 44..120 159 40.7 Plus
Cpr65Ea-PA 127 CG8640-PA 1..120 9..125 158 34.1 Plus
Cpr49Ae-PA 134 CG8505-PA 6..130 11..118 140 30.4 Plus
Cpr47Eg-PA 117 CG9070-PA 34..115 46..118 135 37.8 Plus
Lcp2-PB 126 CG8697-PB 42..121 46..121 135 37.5 Plus
Lcp2-PA 126 CG8697-PA 42..121 46..121 135 37.5 Plus
Lcp1-PB 130 CG11650-PB 46..125 46..121 135 37.5 Plus
Lcp1-PA 130 CG11650-PA 46..125 46..121 135 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12196-PA 131 GI12196-PA 34..131 27..127 384 72.3 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..117 9..121 242 41.9 Plus
Dmoj\GI12010-PA 117 GI12010-PA 1..116 1..118 235 38.8 Plus
Dmoj\GI17470-PA 174 GI17470-PA 9..119 14..117 223 44.1 Plus
Dmoj\GI12994-PA 134 GI12994-PA 4..117 11..121 194 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24591-PA 125 GL24591-PA 1..125 1..127 449 70.1 Plus
Dper\GL24590-PA 121 GL24590-PA 1..115 9..119 246 43.5 Plus
Dper\GL24679-PA 120 GL24679-PA 2..120 4..121 244 42.6 Plus
Dper\GL24678-PA 119 GL24678-PA 4..116 11..117 229 38.9 Plus
Dper\GL25976-PA 192 GL25976-PA 5..120 7..117 187 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23360-PA 125 GA23360-PA 1..125 1..127 449 70.1 Plus
Dpse\GA20516-PA 121 GA20516-PA 1..115 9..119 245 43.5 Plus
Dpse\GA20507-PA 120 GA20507-PA 2..120 4..121 243 42.6 Plus
Dpse\GA23947-PA 119 GA23947-PA 4..116 11..117 229 38.9 Plus
Dpse\Pcp-PA 250 GA17453-PA 63..178 7..117 186 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22151-PA 126 GM22151-PA 1..126 2..127 664 99.2 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..122 9..126 244 40.2 Plus
Dsec\GM22355-PA 120 GM22355-PA 35..117 39..118 228 50.6 Plus
Dsec\GM25234-PA 122 GM25234-PA 3..114 6..117 188 38.8 Plus
Dsec\GM22353-PA 140 GM22353-PA 44..128 35..116 176 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12127-PA 126 GD12127-PA 1..126 2..127 663 98.4 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..122 9..126 244 40.2 Plus
Dsim\GD14949-PA 120 GD14949-PA 35..117 39..118 229 50.6 Plus
Dsim\GD14266-PA 116 GD14266-PA 1..116 8..116 188 38.8 Plus
Dsim\GD14947-PA 140 GD14947-PA 44..128 35..116 176 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11428-PA 129 GJ11428-PA 37..128 32..126 390 77.9 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..117 9..121 244 41 Plus
Dvir\GJ13281-PA 119 GJ13281-PA 1..117 1..119 223 37.7 Plus
Dvir\GJ14515-PA 176 GJ14515-PA 23..116 27..117 201 42.9 Plus
Dvir\GJ13884-PA 140 GJ13884-PA 45..129 35..116 184 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20427-PA 122 GK20427-PA 24..122 29..127 434 80.8 Plus
Dwil\GK20466-PA 121 GK20466-PA 1..117 2..117 263 42.9 Plus
Dwil\GK20425-PA 121 GK20425-PA 28..113 35..117 225 47.7 Plus
Dwil\GK20465-PA 130 GK20465-PA 35..119 35..116 188 43.5 Plus
Dwil\GK19053-PA 171 GK19053-PA 38..112 44..117 184 46.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22347-PA 126 GE22347-PA 1..126 2..127 558 91.3 Plus
Dyak\GE22715-PA 126 GE22715-PA 1..126 2..127 551 90.5 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..115 9..119 239 42.6 Plus
Dyak\GE22714-PA 120 GE22714-PA 4..114 13..119 237 44.1 Plus
Dyak\GE23051-PA 119 GE23051-PA 37..117 41..118 209 51.9 Plus

RT03410.hyp Sequence

Translation from 1 to 381

> RT03410.hyp
MMSFGKIVVFLVLVLVQLIHCTRFTAPSLDRTIYYRNTPPDPFGHYSFEF
QTTNGITTKGAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQPTGDHIP
AIPLHVIRQLEYIRTHPPVDEIRSRRW

RT03410.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78Ca-PA 127 CG11310-PA 1..127 1..127 680 100 Plus
Edg78E-PB 122 CG7673-PB 28..114 35..118 239 49.4 Plus
Edg78E-PA 122 CG7673-PA 28..114 35..118 239 49.4 Plus
Cpr78Cc-PA 119 CG7658-PA 35..117 39..118 237 50.6 Plus
Cpr67Fa2-PA 134 CG18349-PA 38..126 42..126 187 47.2 Plus