Clone RT03431 Report

Search the DGRC for RT03431

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:34
Well:31
Vector:pCR2.1
Associated Gene/TranscriptOsi1-RA
Protein status:RT03431.pep: gold
Sequenced Size:927

Clone Sequence Records

RT03431.complete Sequence

927 bp assembled on 2010-06-21

GenBank Submission: BT100152.4

> RT03431.complete
ATGCTGCTGTGTCGCGTTGTGCTGGCACTGCTGCTGCTGGTGCTACTCCA
CTACTGCCAGGCGAAGGATGAAGGTGAAACCACACAGCGTGGAGCAGTGC
TGGTCTCACTGACTGAGAACATGGCCAAATCGGCAGGATCGCAGCTCGTC
CAAGCCGATCCCTTCATCTCGCGCAACCAGAAGCAGTGCTTTGAGACCCG
CAGTCTGGTGTCCTGCATCAAGTACAAGACCAGCAAATTGATCTGGAAAC
TGGCCACTAACAGCATGGGCTTCTTCCCCAGCGAGTACGGGCGCGATCTG
GCCGGGGACAGAGGCCGCTGGCTGAGATTAGTCCAGTTGGGCGAGCCCGC
CGATGAGGTGGTCGTGTTCAACGACGCTAAGAGCTTAGAAGGTGACAGTG
AACTGACGATGATTCTCAAGTTCCTGAAAAGGGCAATGGAGACGTTTGGG
CGAAACCACGGACTCCAACTGAGGCTGAACAGCGAGGGTGGAGCGAGAGT
CATGGAGGAATCGGAAGCACGATTGAAGCGCAAGAAGAAGAAGTGGCTCA
TTATCCTGCCCCTCGTCATTCTGATGAAGATTGCCCACCTGAAGATGACT
TTGGTGAGCATGCTGATGGGCGTGCTCGGCATGAACGTGCTGCTGGTCGG
CGGCGTGGGCTGGCTGATCCACTACCTTAAGTACAAGACCATGTGCAAGA
TCCACCCGCATCTGGTGCAGACGCACTCGCACGTCTACGAGTCAGATCCC
TCGGACTACTCCCAGTTCGTGGGCAGCGGTAGCTACTCCAACTCGTACTC
CCCGTACAGCTCCGGATCGGGGGCTCCTCACGAGTTGGGCGGCAATAGCT
ACAGCAAGGACTGGGCCACGAGTAAGGCCTACAACGCGCACAACTATCTT
GACACGATCAGCAAGCGGATACAGTAG

RT03431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Osi1-RA 1161 Osi1-RA 97..1023 1..927 4635 100 Plus
Osi1.a 1725 Osi1.a 97..1023 1..927 4635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2000075..2000488 514..927 2055 99.8 Plus
chr3R 27901430 chr3R 1999300..1999693 1..394 1970 100 Plus
chr3R 27901430 chr3R 1999888..2000014 388..514 620 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6174420..6174833 514..927 2070 100 Plus
3R 32079331 3R 6173645..6174038 1..394 1970 100 Plus
3R 32079331 3R 6174233..6174359 388..514 635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5915251..5915664 514..927 2070 100 Plus
3R 31820162 3R 5914476..5914869 1..394 1970 100 Plus
3R 31820162 3R 5915064..5915190 388..514 635 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:30:05 has no hits.

RT03431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:30:47 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1999300..1999690 1..391 100 -> Plus
chr3R 1999892..2000014 392..514 99 -> Plus
chr3R 2000076..2000488 515..927 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2011-03-16 13:21:45 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:36:59 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:12:40 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:36 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-21 18:05:29 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:36:59 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:12:40 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 97..1023 1..927 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:36 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
Osi1-RA 97..1023 1..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:47 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6173645..6174035 1..391 100 -> Plus
3R 6174237..6174359 392..514 100 -> Plus
3R 6174421..6174833 515..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:47 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6173645..6174035 1..391 100 -> Plus
3R 6174237..6174359 392..514 100 -> Plus
3R 6174421..6174833 515..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:47 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6173645..6174035 1..391 100 -> Plus
3R 6174237..6174359 392..514 100 -> Plus
3R 6174421..6174833 515..927 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:12:40 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1999367..1999757 1..391 100 -> Plus
arm_3R 1999959..2000081 392..514 100 -> Plus
arm_3R 2000143..2000555 515..927 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:41 Download gff for RT03431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5914476..5914866 1..391 100 -> Plus
3R 5915068..5915190 392..514 100 -> Plus
3R 5915252..5915664 515..927 100   Plus

RT03431.pep Sequence

Translation from 0 to 926

> RT03431.pep
MLLCRVVLALLLLVLLHYCQAKDEGETTQRGAVLVSLTENMAKSAGSQLV
QADPFISRNQKQCFETRSLVSCIKYKTSKLIWKLATNSMGFFPSEYGRDL
AGDRGRWLRLVQLGEPADEVVVFNDAKSLEGDSELTMILKFLKRAMETFG
RNHGLQLRLNSEGGARVMEESEARLKRKKKKWLIILPLVILMKIAHLKMT
LVSMLMGVLGMNVLLVGGVGWLIHYLKYKTMCKIHPHLVQTHSHVYESDP
SDYSQFVGSGSYSNSYSPYSSGSGAPHELGGNSYSKDWATSKAYNAHNYL
DTISKRIQ*

RT03431.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16371-PA 304 GF16371-PA 1..304 1..308 1177 78.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13122-PA 308 GG13122-PA 17..308 17..308 1347 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14014-PA 579 GH14014-PA 405..579 131..308 614 73 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Osi1-PA 308 CG15585-PA 1..308 1..308 1593 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24386-PA 331 GI24386-PA 70..331 42..308 858 67.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24048-PA 147 GL24048-PA 1..128 1..130 401 61.2 Plus
Dper\GL24049-PA 76 GL24049-PA 5..76 220..308 308 67.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13829-PB 304 GA13829-PB 1..304 1..308 1194 75.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10858-PA 306 GM10858-PA 17..306 17..308 1338 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19841-PA 308 GD19841-PA 1..308 1..308 1610 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14243-PA 323 GJ14243-PA 53..323 35..308 989 72.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13029-PA 308 GK13029-PA 1..308 1..308 1108 71.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10183-PA 308 GE10183-PA 17..308 17..308 1302 94.5 Plus

RT03431.hyp Sequence

Translation from 1 to 926

> RT03431.hyp
MLLCRVVLALLLLVLLHYCQAKDEGETTQRGAVLVSLTENMAKSAGSQLV
QADPFISRNQKQCFETRSLVSCIKYKTSKLIWKLATNSMGFFPSEYGRDL
AGDRGRWLRLVQLGEPADEVVVFNDAKSLEGDSELTMILKFLKRAMETFG
RNHGLQLRLNSEGGARVMEESEARLKRKKKKWLIILPLVILMKIAHLKMT
LVSMLMGVLGMNVLLVGGVGWLIHYLKYKTMCKIHPHLVQTHSHVYESDP
SDYSQFVGSGSYSNSYSPYSSGSGAPHELGGNSYSKDWATSKAYNAHNYL
DTISKRIQ*

RT03431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Osi1-PA 308 CG15585-PA 1..308 1..308 1593 100 Plus