Clone RT03506 Report

Search the DGRC for RT03506

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:35
Well:6
Vector:pCR2.1
Associated Gene/TranscriptCpr47Ec-RA
Protein status:RT03506.pep: gold
Sequenced Size:396

Clone Sequence Records

RT03506.complete Sequence

396 bp assembled on 2010-06-21

GenBank Submission: BT100144.4

> RT03506.complete
ATGTGCAAGATCCTTCCTCTTTTCGTCCTGGCGGTCATGGTGGCCTGTGG
TCAAGCTCTTCCCGTAGATCCCGAACGTGAACCCGTGGCTATCCTGAAGT
CCGAGATCATCAAGACAGAGGAGGGCTACACCAGCGCCTACGTGGGAGCA
GATGGTATATCTCGCAACGAGGAGGCTTTTTTGGTGGACAAGGGTACCGA
CGAGGAGGCTCTGGAGGTGAAGGGATCCTACAAGTACATAAACGAAGACG
GCCAGGAGGTGGAGGTGTTCTATACGGCGGGAAAGAACGGATTTGTTCCC
TACGGCAGCATTATCAATCCGGAAATCACGGCCGTTGCCGAAGCAGCCAA
GGATCTGCCAAAGGTGGAGAAGGTGGAGAAGGCGGGTAGGCCTTAG

RT03506.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Ec-RA 744 Cpr47Ec-RA 138..533 1..396 1980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7146781..7147164 396..13 1920 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11259317..11259700 396..13 1920 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11260516..11260899 396..13 1920 100 Minus
Blast to na_te.dros performed 2019-03-16 10:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 33..65 47..15 102 78.8 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9063..9095 47..15 102 78.8 Minus

RT03506.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:53:58 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7146781..7147164 13..396 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2011-03-16 13:21:45 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:37:00 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:59 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:07 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-21 18:05:22 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:37:00 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 1..396 1..396 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:59 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 138..533 1..396 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:07 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Ec-RA 138..533 1..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:58 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11259317..11259700 13..396 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:58 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11259317..11259700 13..396 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:58 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11259317..11259700 13..396 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:59 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7146822..7147205 13..396 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:42 Download gff for RT03506.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11260516..11260899 13..396 100 <- Minus

RT03506.pep Sequence

Translation from 0 to 395

> RT03506.pep
MCKILPLFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGA
DGISRNEEAFLVDKGTDEEALEVKGSYKYINEDGQEVEVFYTAGKNGFVP
YGSIINPEITAVAEAAKDLPKVEKVEKAGRP*

RT03506.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12426-PA 130 GF12426-PA 1..123 1..122 423 70.7 Plus
Dana\GF12537-PA 207 GF12537-PA 21..135 17..130 260 52.2 Plus
Dana\GF24646-PA 137 GF24646-PA 1..118 1..114 213 43.7 Plus
Dana\GF10920-PA 111 GF10920-PA 15..105 12..102 154 38 Plus
Dana\GF23520-PA 108 GF23520-PA 39..103 41..105 145 47.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22685-PA 129 GG22685-PA 1..128 1..127 547 85.9 Plus
Dere\GG20182-PA 218 GG20182-PA 6..135 1..130 236 44.3 Plus
Dere\GG13213-PA 137 GG13213-PA 1..118 1..114 207 42.9 Plus
Dere\GG15325-PA 108 GG15325-PA 3..101 8..103 157 38.4 Plus
Dere\GG14081-PA 111 GG14081-PA 15..105 12..102 157 36.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21942-PA 129 GH21942-PA 1..123 1..121 298 51.2 Plus
Dgri\GH19947-PA 265 GH19947-PA 5..136 4..130 234 44.4 Plus
Dgri\GH15102-PA 131 GH15102-PA 1..123 1..119 198 40.3 Plus
Dgri\GH21941-PA 143 GH21941-PA 1..138 4..123 174 36.7 Plus
Dgri\GH13967-PA 99 GH13967-PA 1..93 2..102 155 37.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Ec-PA 131 CG9077-PA 1..131 1..131 666 100 Plus
Cpr47Eb-PA 214 CG13224-PA 8..135 4..130 240 43.8 Plus
Cpr78E-PA 137 CG7160-PA 1..122 1..118 210 42.3 Plus
Lcp65Ad-PB 108 CG6955-PB 12..101 13..103 162 39.6 Plus
Lcp65Ad-PA 108 CG6955-PA 12..101 13..103 162 39.6 Plus
Cpr47Ed-PA 127 CG9076-PA 27..102 28..101 154 48.7 Plus
Cpr65Av-PA 111 CG32405-PA 21..105 18..102 148 35.3 Plus
Lcp65Af-PA 100 CG10533-PA 18..92 29..103 145 41.3 Plus
Cpr47Ef-PD 601 CG13214-PD 149..230 43..119 144 39 Plus
Cpr47Ef-PC 612 CG13214-PC 149..230 43..119 144 39 Plus
Cpr65Ax2-PB 102 CG18777-PB 6..94 9..103 142 35.8 Plus
Cpr65Ax2-PA 102 CG18777-PA 6..94 9..103 142 35.8 Plus
Cpr65Ax1-PA 102 CG34270-PA 6..94 9..103 142 35.8 Plus
Lcp65Ag2-PA 105 CG10534-PA 4..97 10..103 141 37.2 Plus
Lcp65Ag1-PA 105 CG10530-PA 4..97 10..103 141 37.2 Plus
Lcp65Ag3-PA 105 CG18779-PA 4..97 10..103 140 37.2 Plus
Lcp65Ac-PA 109 CG6956-PA 28..100 31..103 140 41.1 Plus
Cpr49Aa-PB 144 CG30045-PB 6..105 7..102 137 31 Plus
Acp65Aa-PA 105 CG10297-PA 11..101 10..103 134 33.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19649-PA 184 GI19649-PA 54..170 5..121 392 69.5 Plus
Dmoj\GI19904-PA 384 GI19904-PA 8..142 7..130 230 45.9 Plus
Dmoj\GI13751-PA 145 GI13751-PA 35..121 29..117 164 47.8 Plus
Dmoj\GI12698-PA 111 GI12698-PA 9..108 8..105 149 37.3 Plus
Dmoj\GI12620-PA 104 GI12620-PA 5..101 5..105 147 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16751-PA 132 GL16751-PA 1..120 1..121 383 75.4 Plus
Dper\GL17720-PA 240 GL17720-PA 32..129 26..122 239 53.1 Plus
Dper\GL25283-PA 138 GL25283-PA 1..136 1..131 218 41.2 Plus
Dper\GL15515-PA 111 GL15515-PA 11..105 5..102 163 37.8 Plus
Dper\GL15560-PA 102 GL15560-PA 5..99 7..105 156 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21523-PA 132 GA21523-PA 1..120 1..121 383 75.4 Plus
Dpse\GA12136-PA 240 GA12136-PA 32..129 26..122 240 53.1 Plus
Dpse\GA20144-PA 138 GA20144-PA 1..136 1..131 218 41.2 Plus
Dpse\GA16877-PA 111 GA16877-PA 11..105 5..102 163 37.8 Plus
Dpse\GA20238-PA 102 GA20238-PA 4..99 7..105 155 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20463-PA 131 GM20463-PA 1..131 1..131 595 89.3 Plus
Dsec\GM21270-PA 214 GM21270-PA 6..135 1..130 234 43.5 Plus
Dsec\GM22121-PA 137 GM22121-PA 1..126 1..121 208 41.7 Plus
Dsec\GM20462-PA 127 GM20462-PA 1..102 7..101 163 42.2 Plus
Dsec\GM13864-PA 111 GM13864-PA 6..105 7..102 162 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25932-PA 131 GD25932-PA 1..131 1..131 586 88.5 Plus
Dsim\GD10782-PA 214 GD10782-PA 6..135 1..130 232 43.5 Plus
Dsim\GD12099-PA 137 GD12099-PA 1..126 1..121 215 42.5 Plus
Dsim\GD25931-PA 117 GD25931-PA 1..102 7..101 162 42.2 Plus
Dsim\GD13147-PA 111 GD13147-PA 6..105 7..102 162 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15016-PA 129 GJ15016-PA 1..124 1..124 393 66.4 Plus
Dvir\GJ15073-PA 196 GJ15073-PA 8..126 7..121 241 49.6 Plus
Dvir\GJ14096-PA 140 GJ14096-PA 1..123 1..118 178 39.5 Plus
Dvir\GJ12683-PA 111 GJ12683-PA 8..105 7..102 157 40 Plus
Dvir\GJ15015-PA 145 GJ15015-PA 1..133 1..116 150 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20647-PA 131 GK20647-PA 1..123 1..121 381 65.9 Plus
Dwil\GK20958-PA 197 GK20958-PA 1..131 1..126 270 47 Plus
Dwil\GK17131-PA 137 GK17131-PA 1..123 1..119 198 41.6 Plus
Dwil\GK17266-PA 115 GK17266-PA 10..110 2..105 178 39.4 Plus
Dwil\GK16920-PA 111 GK16920-PA 6..105 7..102 156 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13040-PA 129 GE13040-PA 1..128 1..127 552 87.5 Plus
Dyak\GE12869-PA 216 GE12869-PA 6..135 1..130 233 43.5 Plus
Dyak\GE22306-PA 137 GE22306-PA 1..118 1..114 206 42.9 Plus
Dyak\GE22707-PA 137 GE22707-PA 1..118 1..114 206 42.9 Plus
Dyak\GE20507-PA 111 GE20507-PA 15..105 12..102 155 36.3 Plus

RT03506.hyp Sequence

Translation from 1 to 395

> RT03506.hyp
MCKILPLFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGA
DGISRNEEAFLVDKGTDEEALEVKGSYKYINEDGQEVEVFYTAGKNGFVP
YGSIINPEITAVAEAAKDLPKVEKVEKAGRP*

RT03506.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Ec-PA 131 CG9077-PA 1..131 1..131 666 100 Plus
Cpr47Eb-PA 214 CG13224-PA 8..135 4..130 240 43.8 Plus
Cpr78E-PA 137 CG7160-PA 1..122 1..118 210 42.3 Plus
Lcp65Ad-PB 108 CG6955-PB 12..101 13..103 162 39.6 Plus
Lcp65Ad-PA 108 CG6955-PA 12..101 13..103 162 39.6 Plus