BDGP Sequence Production Resources |
Search the DGRC for RT03513
Library: | RT |
Tissue Source: | D melanogaster pooled RNA |
Created by: | |
Date Registered: | 2006-04-14 |
Comments: | TA cloning vector from Invitrogen |
Original Plate Number: | 35 |
Well: | 13 |
Vector: | pCR2.1 |
Associated Gene/Transcript | Eig71Ei-RA |
Protein status: | RT03513.pep: gold |
Sequenced Size: | 382 |
382 bp assembled on 2009-10-30
GenBank Submission: BT100153.1
> RT03513.complete ACCTTAAAACTATTTCAAGCGTTACGCCATGTTAAAACTTTTGCTGCCAT TAGCTATTGTGTGCCTGTTTATGGCTCACATACAAGCCAATCCCGAAGAA GCTAACAGGCGTCATAAAATCTGCATTCGCACCTACGATAAGTGTATTGA AAATGAAGCTAGGTTGGGAAAACAGGACGATACTTCAAAGTTCTTTAACG ACTACTGTCGCCGTTCGGATTCTGGATGGTCAGATGTTAGCCGATGTGAT CTTCTGCGAATAGCCTGTTTATCTACTGTGCGCGATTGCGAAACACCGAC TTGCAAGAATGTTGCCCACCGCATGCGTCTTTGGTGAAAATTTTAAACCA CCCTAAATAAACTGAAAGCGAGAAATGATATT
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ei-RA | 583 | Eig71Ei-RA | 61..442 | 1..382 | 1910 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15649721..15649941 | 52..272 | 1105 | 100 | Plus |
chr3L | 24539361 | chr3L | 15650003..15650112 | 273..382 | 550 | 100 | Plus |
chr3L | 24539361 | chr3L | 15649616..15649668 | 1..53 | 265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15649616..15649668 | 1..53 | 100 | -> | Plus |
chr3L | 15649723..15649941 | 54..272 | 100 | -> | Plus |
chr3L | 15650003..15650112 | 273..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 1..309 | 29..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 1..309 | 29..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 1..309 | 29..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 1..309 | 29..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 8..389 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 8..389 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 8..389 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ei-RA | 8..389 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15660101..15660210 | 273..382 | 100 | Plus | |
3L | 15659714..15659766 | 1..53 | 100 | -> | Plus |
3L | 15659821..15660039 | 54..272 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15660101..15660210 | 273..382 | 100 | Plus | |
3L | 15659714..15659766 | 1..53 | 100 | -> | Plus |
3L | 15659821..15660039 | 54..272 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15660101..15660210 | 273..382 | 100 | Plus | |
3L | 15659714..15659766 | 1..53 | 100 | -> | Plus |
3L | 15659821..15660039 | 54..272 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15652814..15652866 | 1..53 | 100 | -> | Plus |
arm_3L | 15652921..15653139 | 54..272 | 100 | -> | Plus |
arm_3L | 15653201..15653310 | 273..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15652814..15652866 | 1..53 | 100 | -> | Plus |
3L | 15653201..15653310 | 273..382 | 100 | Plus | |
3L | 15652921..15653139 | 54..272 | 100 | -> | Plus |
Translation from 28 to 336
> RT03513.hyp MLKLLLPLAIVCLFMAHIQANPEEANRRHKICIRTYDKCIENEARLGKQD DTSKFFNDYCRRSDSGWSDVSRCDLLRIACLSTVRDCETPTCKNVAHRMR LW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ei-PB | 102 | CG7327-PB | 1..102 | 1..102 | 557 | 100 | Plus |
Eig71Ei-PA | 102 | CG7327-PA | 1..102 | 1..102 | 557 | 100 | Plus |
Eig71Eg-PA | 98 | CG7336-PA | 1..97 | 1..100 | 193 | 37 | Plus |
Eig71Eb-PB | 95 | CG7355-PB | 1..89 | 1..95 | 171 | 35.8 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..89 | 1..95 | 171 | 35.8 | Plus |
Translation from 28 to 336
> RT03513.pep MLKLLLPLAIVCLFMAHIQANPEEANRRHKICIRTYDKCIENEARLGKQD DTSKFFNDYCRRSDSGWSDVSRCDLLRIACLSTVRDCETPTCKNVAHRMR LW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24089-PA | 122 | GF24089-PA | 39..121 | 15..100 | 175 | 38.4 | Plus |
Dana\GF24086-PA | 100 | GF24086-PA | 1..95 | 1..100 | 162 | 35.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15921-PA | 102 | GG15921-PA | 1..102 | 1..102 | 485 | 88.2 | Plus |
Dere\GG15920-PA | 98 | GG15920-PA | 1..97 | 1..100 | 196 | 39 | Plus |
Dere\GG15917-PA | 94 | GG15917-PA | 4..89 | 4..95 | 163 | 38.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ei-PB | 102 | CG7327-PB | 1..102 | 1..102 | 557 | 100 | Plus |
Eig71Ei-PA | 102 | CG7327-PA | 1..102 | 1..102 | 557 | 100 | Plus |
Eig71Eg-PA | 98 | CG7336-PA | 1..97 | 1..100 | 193 | 37 | Plus |
Eig71Eb-PB | 95 | CG7355-PB | 1..89 | 1..95 | 171 | 35.8 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..89 | 1..95 | 171 | 35.8 | Plus |
Eig71Ec-PA | 173 | CG7608-PA | 1..92 | 1..95 | 170 | 41.2 | Plus |
Eig71Ek-PA | 97 | CG7325-PA | 1..97 | 1..101 | 151 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13624-PA | 97 | GI13624-PA | 1..92 | 1..95 | 175 | 43.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25493-PA | 192 | GL25493-PA | 1..78 | 1..80 | 159 | 43.8 | Plus |
Dper\GL15724-PA | 132 | GL15724-PA | 5..90 | 8..95 | 157 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20289-PA | 216 | GA20289-PA | 1..97 | 1..95 | 183 | 41.8 | Plus |
Dpse\GA23777-PA | 138 | GA23777-PA | 1..93 | 1..95 | 173 | 38.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25549-PA | 94 | GM25549-PA | 1..89 | 1..95 | 174 | 40 | Plus |
Dsec\GM25551-PA | 100 | GM25551-PA | 1..94 | 1..95 | 154 | 36.1 | Plus |
Dsec\GM24473-PA | 162 | GM24473-PA | 1..92 | 1..95 | 154 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14565-PA | 102 | GD14565-PA | 1..102 | 1..102 | 527 | 97.1 | Plus |
Dsim\GD14564-PA | 98 | GD14564-PA | 1..97 | 1..100 | 187 | 38 | Plus |
Dsim\GD14562-PA | 94 | GD14562-PA | 1..89 | 1..95 | 164 | 36.8 | Plus |
Dsim\GD12547-PA | 162 | GD12547-PA | 1..96 | 1..99 | 159 | 39.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13962-PA | 94 | GJ13962-PA | 1..93 | 1..100 | 157 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15233-PA | 98 | GK15233-PA | 1..97 | 1..100 | 188 | 38 | Plus |
Dwil\GK20719-PA | 124 | GK20719-PA | 6..96 | 4..100 | 160 | 37.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22267-PA | 102 | GE22267-PA | 1..102 | 1..102 | 506 | 92.2 | Plus |
Dyak\GE23157-PA | 102 | GE23157-PA | 1..102 | 1..102 | 506 | 92.2 | Plus |
Dyak\GE23156-PA | 98 | GE23156-PA | 1..97 | 1..100 | 179 | 35 | Plus |
Dyak\GE22266-PA | 98 | GE22266-PA | 1..97 | 1..100 | 175 | 35 | Plus |
Dyak\GE22264-PA | 95 | GE22264-PA | 1..89 | 1..95 | 152 | 34.7 | Plus |