Clone RT03513 Report

Search the DGRC for RT03513

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:35
Well:13
Vector:pCR2.1
Associated Gene/TranscriptEig71Ei-RA
Protein status:RT03513.pep: gold
Sequenced Size:382

Clone Sequence Records

RT03513.complete Sequence

382 bp assembled on 2009-10-30

GenBank Submission: BT100153.1

> RT03513.complete
ACCTTAAAACTATTTCAAGCGTTACGCCATGTTAAAACTTTTGCTGCCAT
TAGCTATTGTGTGCCTGTTTATGGCTCACATACAAGCCAATCCCGAAGAA
GCTAACAGGCGTCATAAAATCTGCATTCGCACCTACGATAAGTGTATTGA
AAATGAAGCTAGGTTGGGAAAACAGGACGATACTTCAAAGTTCTTTAACG
ACTACTGTCGCCGTTCGGATTCTGGATGGTCAGATGTTAGCCGATGTGAT
CTTCTGCGAATAGCCTGTTTATCTACTGTGCGCGATTGCGAAACACCGAC
TTGCAAGAATGTTGCCCACCGCATGCGTCTTTGGTGAAAATTTTAAACCA
CCCTAAATAAACTGAAAGCGAGAAATGATATT

RT03513.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ei-RA 583 Eig71Ei-RA 61..442 1..382 1910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15649721..15649941 52..272 1105 100 Plus
chr3L 24539361 chr3L 15650003..15650112 273..382 550 100 Plus
chr3L 24539361 chr3L 15649616..15649668 1..53 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15659819..15660039 52..272 1105 100 Plus
3L 28110227 3L 15660101..15660210 273..382 550 100 Plus
3L 28110227 3L 15659714..15659766 1..53 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15652919..15653139 52..272 1105 100 Plus
3L 28103327 3L 15653201..15653310 273..382 550 100 Plus
3L 28103327 3L 15652814..15652866 1..53 265 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:58:29 has no hits.

RT03513.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:59:28 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15649616..15649668 1..53 100 -> Plus
chr3L 15649723..15649941 54..272 100 -> Plus
chr3L 15650003..15650112 273..382 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 16:17:41 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 1..309 29..337 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:46:25 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 1..309 29..337 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:26 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 1..309 29..337 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:11 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 1..309 29..337 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 16:17:41 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 8..389 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:46:25 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 8..389 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:26 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 8..389 1..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:11 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ei-RA 8..389 1..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:28 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15660101..15660210 273..382 100   Plus
3L 15659714..15659766 1..53 100 -> Plus
3L 15659821..15660039 54..272 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:28 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15660101..15660210 273..382 100   Plus
3L 15659714..15659766 1..53 100 -> Plus
3L 15659821..15660039 54..272 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:28 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15660101..15660210 273..382 100   Plus
3L 15659714..15659766 1..53 100 -> Plus
3L 15659821..15660039 54..272 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:26 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15652814..15652866 1..53 100 -> Plus
arm_3L 15652921..15653139 54..272 100 -> Plus
arm_3L 15653201..15653310 273..382 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:29 Download gff for RT03513.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15652814..15652866 1..53 100 -> Plus
3L 15653201..15653310 273..382 100   Plus
3L 15652921..15653139 54..272 100 -> Plus

RT03513.hyp Sequence

Translation from 28 to 336

> RT03513.hyp
MLKLLLPLAIVCLFMAHIQANPEEANRRHKICIRTYDKCIENEARLGKQD
DTSKFFNDYCRRSDSGWSDVSRCDLLRIACLSTVRDCETPTCKNVAHRMR
LW*

RT03513.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ei-PB 102 CG7327-PB 1..102 1..102 557 100 Plus
Eig71Ei-PA 102 CG7327-PA 1..102 1..102 557 100 Plus
Eig71Eg-PA 98 CG7336-PA 1..97 1..100 193 37 Plus
Eig71Eb-PB 95 CG7355-PB 1..89 1..95 171 35.8 Plus
Eig71Eb-PA 95 CG7355-PA 1..89 1..95 171 35.8 Plus

RT03513.pep Sequence

Translation from 28 to 336

> RT03513.pep
MLKLLLPLAIVCLFMAHIQANPEEANRRHKICIRTYDKCIENEARLGKQD
DTSKFFNDYCRRSDSGWSDVSRCDLLRIACLSTVRDCETPTCKNVAHRMR
LW*

RT03513.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24089-PA 122 GF24089-PA 39..121 15..100 175 38.4 Plus
Dana\GF24086-PA 100 GF24086-PA 1..95 1..100 162 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15921-PA 102 GG15921-PA 1..102 1..102 485 88.2 Plus
Dere\GG15920-PA 98 GG15920-PA 1..97 1..100 196 39 Plus
Dere\GG15917-PA 94 GG15917-PA 4..89 4..95 163 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ei-PB 102 CG7327-PB 1..102 1..102 557 100 Plus
Eig71Ei-PA 102 CG7327-PA 1..102 1..102 557 100 Plus
Eig71Eg-PA 98 CG7336-PA 1..97 1..100 193 37 Plus
Eig71Eb-PB 95 CG7355-PB 1..89 1..95 171 35.8 Plus
Eig71Eb-PA 95 CG7355-PA 1..89 1..95 171 35.8 Plus
Eig71Ec-PA 173 CG7608-PA 1..92 1..95 170 41.2 Plus
Eig71Ek-PA 97 CG7325-PA 1..97 1..101 151 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13624-PA 97 GI13624-PA 1..92 1..95 175 43.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25493-PA 192 GL25493-PA 1..78 1..80 159 43.8 Plus
Dper\GL15724-PA 132 GL15724-PA 5..90 8..95 157 37.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20289-PA 216 GA20289-PA 1..97 1..95 183 41.8 Plus
Dpse\GA23777-PA 138 GA23777-PA 1..93 1..95 173 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25549-PA 94 GM25549-PA 1..89 1..95 174 40 Plus
Dsec\GM25551-PA 100 GM25551-PA 1..94 1..95 154 36.1 Plus
Dsec\GM24473-PA 162 GM24473-PA 1..92 1..95 154 40.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14565-PA 102 GD14565-PA 1..102 1..102 527 97.1 Plus
Dsim\GD14564-PA 98 GD14564-PA 1..97 1..100 187 38 Plus
Dsim\GD14562-PA 94 GD14562-PA 1..89 1..95 164 36.8 Plus
Dsim\GD12547-PA 162 GD12547-PA 1..96 1..99 159 39.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13962-PA 94 GJ13962-PA 1..93 1..100 157 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15233-PA 98 GK15233-PA 1..97 1..100 188 38 Plus
Dwil\GK20719-PA 124 GK20719-PA 6..96 4..100 160 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22267-PA 102 GE22267-PA 1..102 1..102 506 92.2 Plus
Dyak\GE23157-PA 102 GE23157-PA 1..102 1..102 506 92.2 Plus
Dyak\GE23156-PA 98 GE23156-PA 1..97 1..100 179 35 Plus
Dyak\GE22266-PA 98 GE22266-PA 1..97 1..100 175 35 Plus
Dyak\GE22264-PA 95 GE22264-PA 1..89 1..95 152 34.7 Plus