Clone RT03535 Report

Search the DGRC for RT03535

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:35
Well:35
Vector:pCR2.1
Associated Gene/TranscriptTwdlQ-RA
Protein status:RT03535.pep: gold
Sequenced Size:738

Clone Sequence Records

RT03535.complete Sequence

738 bp assembled on 2010-06-21

GenBank Submission: BT100154.4

> RT03535.complete
ATGCGAGGATTTCTGTTACTCTTACTCATTGCTTCCGTTTCGGCAGCAAA
ATTGGGCTACAATTACCAAGCTGCTGCTGGCGACCGTCGTTTTGCGGGAC
TCATCGATGCGGAGGCCACAGGATTCAGCTCCACATCTACGCAGCAGCAG
CAGCAGCAACAAGCGCAACAGGAGCTTGTGCAGCAGAACACGCAACAACA
GATTCCAGCTGCTGCGGATGAGTTCAGCAAGGAGTTCTACACCTACGCTG
CACCGGAGGAGGAGTTTGCGGATCAGGAGGCTACCGAGCACATCGCCAGC
ATGCTGAAACGCAATCTCCGCGTGCTGTTCATCAAGTCGCCGGAACACCA
AGGTCTCACCAACGCAGCCCTCCAGTTGGCCAAACAGGCCAGCGAGCAGC
GGACGGCCATCTATGTGCTCAGCAAGCAGGCGGATGTGAGTCAGTTGGCG
CAGCGCCTGGCCAATGAGAATCAGGCCCAAAGCCCCAAGCCGGAGGTGCA
CTTCGTCAAGTACCGCACCCCGGAGGATGCGGTGCGTGCCCAGCAGCTCA
TTCAGCAGCAGTTCGACTCCTTGGGCGGCAGCTCCCGCAGCTCGGACGAG
GGTGTCGCCCCCGTTTTGGACTTTAGCTCAGCACCAGCGGCCATAAGCGT
CCAGGAGCAGAATGAGGCCCAAAATCAGGTTCAGGCAGTAACTCCTCTCA
CAAAGTATTTGCCAGCGGCATTGCTGCGCAACAAGTAG

RT03535.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlQ-RA 984 TwdlQ-RA 162..899 1..738 3690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22515736..22516459 738..15 3575 99.6 Minus
chr3R 27901430 chr3R 22443009..22443053 486..530 180 93.3 Plus
chr3R 27901430 chr3R 22445873..22445917 530..486 180 93.3 Minus
chr3R 27901430 chr3R 22447980..22448024 530..486 180 93.3 Minus
chr3R 27901430 chr3R 22453592..22453636 486..530 180 93.3 Plus
chr3R 27901430 chr3R 22455741..22455785 486..530 180 93.3 Plus
chr3R 27901430 chr3R 22480217..22480297 486..566 180 81.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26692634..26693357 738..15 3620 100 Minus
3R 32079331 3R 17141471..17141596 612..487 180 76.2 Minus
3R 32079331 3R 26622752..26622796 530..486 180 93.3 Minus
3R 32079331 3R 26624862..26624906 530..486 180 93.3 Minus
3R 32079331 3R 26628151..26628195 530..486 180 93.3 Minus
3R 32079331 3R 26630477..26630521 486..530 180 93.3 Plus
3R 32079331 3R 26632626..26632670 486..530 180 93.3 Plus
3R 32079331 3R 26657114..26657194 486..566 180 81.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26433465..26434188 738..15 3620 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:46:20 has no hits.

RT03535.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:15 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22515736..22516458 16..738 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2011-03-16 13:21:30 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:36:50 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:24 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:13 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-21 16:52:45 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:36:50 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:24 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 68..805 1..738 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:13 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlQ-RA 68..805 1..738 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:15 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26692634..26693356 16..738 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:15 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26692634..26693356 16..738 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:15 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26692634..26693356 16..738 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:24 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22518356..22519078 16..738 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:32 Download gff for RT03535.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26433465..26434187 16..738 100 <- Minus

RT03535.pep Sequence

Translation from 0 to 737

> RT03535.pep
MRGFLLLLLIASVSAAKLGYNYQAAAGDRRFAGLIDAEATGFSSTSTQQQ
QQQQAQQELVQQNTQQQIPAAADEFSKEFYTYAAPEEEFADQEATEHIAS
MLKRNLRVLFIKSPEHQGLTNAALQLAKQASEQRTAIYVLSKQADVSQLA
QRLANENQAQSPKPEVHFVKYRTPEDAVRAQQLIQQQFDSLGGSSRSSDE
GVAPVLDFSSAPAAISVQEQNEAQNQVQAVTPLTKYLPAALLRNK*

RT03535.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18571-PA 234 GF18571-PA 1..234 1..245 942 80.1 Plus
Dana\GF16450-PA 256 GF16450-PA 1..199 1..210 477 50.5 Plus
Dana\GF16449-PA 263 GF16449-PA 1..219 1..208 459 48 Plus
Dana\GF16446-PA 245 GF16446-PA 1..242 1..243 443 44.2 Plus
Dana\GF18196-PA 253 GF18196-PA 81..220 72..210 411 60 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12175-PA 244 GG12175-PA 1..244 1..245 1112 93.5 Plus
Dere\GG11494-PA 262 GG11494-PA 1..217 1..208 467 47.9 Plus
Dere\GG12179-PA 239 GG12179-PA 1..235 1..243 447 42.7 Plus
Dere\GG11495-PA 254 GG11495-PA 67..237 74..238 423 54.4 Plus
Dere\GG11489-PA 274 GG11489-PA 1..257 1..240 423 42.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18874-PA 229 GH18874-PA 1..229 1..240 804 74.7 Plus
Dgri\GH18733-PA 249 GH18733-PA 1..189 1..212 525 51.4 Plus
Dgri\GH18876-PA 232 GH18876-PA 1..228 1..243 493 45.1 Plus
Dgri\GH18732-PA 238 GH18732-PA 1..234 1..243 453 44.1 Plus
Dgri\GH18726-PA 286 GH18726-PA 1..282 1..243 447 41.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlQ-PA 245 CG14250-PA 1..245 1..245 1203 100 Plus
TwdlD-PA 256 CG14243-PA 1..237 1..239 504 47.3 Plus
Tb-PA 283 CG5480-PA 1..243 1..230 472 42.4 Plus
TwdlH-PA 241 CG31080-PA 1..238 1..243 451 42.3 Plus
TwdlK-PA 247 CG6460-PA 1..243 1..243 448 43.3 Plus
TwdlJ-PB 274 CG5471-PB 8..257 5..240 444 41.6 Plus
TwdlN-PA 309 CG5476-PA 139..303 69..243 435 52.6 Plus
TwdlL-PB 279 CG6447-PB 112..278 69..245 431 51.4 Plus
TwdlL-PA 285 CG6447-PA 118..284 69..245 431 51.4 Plus
TwdlB-PA 286 CG6478-PA 118..282 69..243 430 52.6 Plus
TwdlO-PA 229 CG6452-PA 4..224 7..243 423 41.4 Plus
TwdlM-PA 288 CG5468-PA 122..286 69..243 422 50.3 Plus
TwdlP-PA 220 CG14240-PA 1..215 1..242 411 41.1 Plus
TwdlF-PA 354 CG14639-PA 109..277 45..210 317 41.5 Plus
TwdlV-PA 251 CG14640-PA 1..204 1..205 305 39.2 Plus
TwdlR-PA 325 CG31081-PA 11..199 1..208 288 36.4 Plus
TwdlW-PA 308 CG4060-PA 130..278 76..228 273 40.9 Plus
TwdlG-PC 278 CG14643-PC 72..276 41..241 247 34.4 Plus
TwdlG-PB 278 CG14643-PB 72..276 41..241 247 34.4 Plus
TwdlG-PA 278 CG14643-PA 72..276 41..241 247 34.4 Plus
TwdlX-PA 346 CG32571-PA 146..275 74..205 228 38.6 Plus
Twdlalpha-PA 388 CG32574-PA 130..318 27..216 227 34 Plus
TwdlY-PA 247 CG32570-PA 79..245 76..241 225 33.1 Plus
TwdlS-PA 228 CG14242-PA 42..168 70..197 203 38.5 Plus
TwdlZ-PB 210 CG32569-PB 29..190 69..232 201 34.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24731-PA 233 GI24731-PA 1..233 1..240 789 72.2 Plus
Dmoj\GI22885-PA 290 GI22885-PA 1..229 1..210 478 47.2 Plus
Dmoj\GI22884-PA 255 GI22884-PA 1..239 1..242 460 44 Plus
Dmoj\GI22881-PA 240 GI22881-PA 1..239 1..245 446 42.1 Plus
Dmoj\GI10846-PA 240 GI10846-PA 22..213 4..210 439 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24435-PA 251 GL24435-PA 1..250 1..244 893 75.3 Plus
Dper\GL23105-PA 254 GL23105-PA 1..238 1..242 478 48.8 Plus
Dper\GL23102-PA 264 GL23102-PA 1..263 1..245 457 42.6 Plus
Dper\GL23106-PA 301 GL23106-PA 96..232 74..210 426 62 Plus
Dper\GL24443-PA 277 GL24443-PA 114..272 76..242 423 53.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12860-PA 247 GA12860-PA 1..247 1..245 894 75.8 Plus
Dpse\GA12855-PA 254 GA12855-PA 1..238 1..242 483 49.6 Plus
Dpse\GA27141-PA 264 GA27141-PA 1..263 1..245 454 42.3 Plus
Dpse\GA12853-PA 225 GA12853-PA 1..220 1..242 439 43 Plus
Dpse\GA18913-PA 299 GA18913-PA 96..232 74..210 427 62 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10172-PA 244 GM10172-PA 1..244 1..245 1159 96.7 Plus
Dsec\GM10337-PA 256 GM10337-PA 1..240 1..242 500 46.3 Plus
Dsec\GM10334-PA 241 GM10334-PA 1..238 1..243 424 43 Plus
Dsec\GM10338-PA 262 GM10338-PA 1..213 1..210 411 45.5 Plus
Dsec\GM10175-PA 247 GM10175-PA 1..243 1..243 409 43.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18124-PA 245 GD18124-PA 1..245 1..245 1239 98.4 Plus
Dsim\GD21297-PA 256 GD21297-PA 1..216 1..212 486 48.6 Plus
Dsim\GD21294-PA 241 GD21294-PA 1..238 1..243 424 43 Plus
Dsim\GD21298-PA 284 GD21298-PA 92..228 74..210 410 59.1 Plus
Dsim\GD18127-PA 247 GD18127-PA 1..243 1..243 396 41.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14557-PA 226 GJ14557-PA 1..226 1..240 798 71.7 Plus
Dvir\GJ14179-PA 255 GJ14179-PA 1..251 1..243 481 46.9 Plus
Dvir\GJ14180-PA 255 GJ14180-PA 1..193 1..210 478 49.5 Plus
Dvir\GJ14173-PA 284 GJ14173-PA 7..280 4..243 451 40.9 Plus
Dvir\GJ14453-PA 215 GJ14453-PA 1..215 1..236 450 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13956-PA 242 GK13956-PA 1..242 1..245 875 75.2 Plus
Dwil\GK13324-PA 260 GK13324-PA 2..216 1..208 478 50.2 Plus
Dwil\GK13964-PA 225 GK13964-PA 1..219 1..243 468 43.9 Plus
Dwil\GK13327-PA 274 GK13327-PA 1..221 1..220 441 48 Plus
Dwil\GK13323-PA 246 GK13323-PA 1..245 1..245 430 43.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10619-PA 245 GE10619-PA 1..245 1..245 1167 95.9 Plus
Dyak\GE23685-PA 268 GE23685-PA 1..219 1..211 476 48.6 Plus
Dyak\GE23681-PA 234 GE23681-PA 1..231 1..243 421 44.7 Plus
Dyak\GE23686-PA 288 GE23686-PA 96..232 74..210 419 61.3 Plus
Dyak\GE10623-PA 247 GE10623-PA 1..243 1..243 394 42 Plus

RT03535.hyp Sequence

Translation from 1 to 737

> RT03535.hyp
MRGFLLLLLIASVSAAKLGYNYQAAAGDRRFAGLIDAEATGFSSTSTQQQ
QQQQAQQELVQQNTQQQIPAAADEFSKEFYTYAAPEEEFADQEATEHIAS
MLKRNLRVLFIKSPEHQGLTNAALQLAKQASEQRTAIYVLSKQADVSQLA
QRLANENQAQSPKPEVHFVKYRTPEDAVRAQQLIQQQFDSLGGSSRSSDE
GVAPVLDFSSAPAAISVQEQNEAQNQVQAVTPLTKYLPAALLRNK*

RT03535.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlQ-PA 245 CG14250-PA 1..245 1..245 1203 100 Plus
TwdlD-PA 256 CG14243-PA 1..237 1..239 504 47.3 Plus
Tb-PA 283 CG5480-PA 1..243 1..230 472 42.4 Plus
TwdlH-PA 241 CG31080-PA 1..238 1..243 451 42.3 Plus
TwdlK-PA 247 CG6460-PA 1..243 1..243 448 43.3 Plus