Clone RT03811 Report

Search the DGRC for RT03811

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:38
Well:11
Vector:pCR2.1
Associated Gene/TranscriptCpr76Bb-RA
Protein status:RT03811.pep: gold
Sequenced Size:600

Clone Sequence Records

RT03811.complete Sequence

600 bp assembled on 2009-12-10

GenBank Submission: BT120008.1

> RT03811.complete
ATGAAATCCTTTAGCGGAGGTCTGTTCTTTGCCCTTCTGGTGGGAGCCAG
TTGGGCAGCTCCCCATGGTGGACACGCCACCAGCTACAGTTCGGTGACCA
AGCACGAAGGACCCGTCCACAAGAGCCTGGGCTACGGATACGATCACGAT
GTGGTCAGCGCTTACGGTGGCATCTACGGACACGGCTATCCGAGTGTCGG
CCATTCGGGCTACGGATACGGATACGACAAGCACGAGCCCCATCACTATC
CCAAGTACCAATTCGACTACGGCGTCAAGGATGCCCACACCGGAGACCAG
AAGAGCCAGTGGGAGACGCGGGATGGCGACAAGGTCAAGGGCAGCTACTC
CCTCAAGGAATCGGATGGCACCACCCGAGTGGTGGAGTACACCGCCGATG
ACCACAATGGCTTCAACGCAGTGGTAAAGAAGCTCGGCCACGCCCACCAC
CCCCAGGTCTACCACAAGGGCTACGGACACGGCGATATCTACGACGCCGA
CTACGGCTACGGTCACGATGTGGCGCAATATGGCGGATACGGATACGGAC
ACGGAGGCCACGCCAGTAGCTACGTAAGCGTGAAGCAGCTGCACTAACAC

RT03811.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr76Bb-RA 597 Cpr76Bb-RA 1..597 1..597 2985 100 Plus
Cpr76Ba-RA 615 Cpr76Ba-RA 286..401 244..359 205 78.4 Plus
Cpr62Bc-RA 1314 Cpr62Bc-RA 540..577 382..419 190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19509097..19509693 1..597 2940 99.5 Plus
chr3L 24539361 chr3L 19507260..19507430 414..244 225 75.4 Minus
chr3L 24539361 chr3L 1840542..1840579 419..382 190 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19519695..19520291 1..597 2985 100 Plus
3L 28110227 3L 19517820..19517990 414..244 225 75.4 Minus
3L 28110227 3L 1841012..1841049 419..382 190 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19512795..19513391 1..597 2985 100 Plus
3L 28103327 3L 19510975..19511090 359..244 205 78.4 Minus
3L 28103327 3L 1841012..1841049 419..382 190 100 Minus
Blast to na_te.dros performed 2019-03-16 16:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dm88 4558 Dm88 DM88 4558bp 2693..2769 208..284 105 64.6 Plus

RT03811.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:28:35 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19509097..19509695 1..600 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:05:25 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:27:11 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:40 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:29:14 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:05:17 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:27:11 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:40 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 47..645 1..600 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:29:14 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr76Bb-RA 47..645 1..600 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:35 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19519695..19520293 1..600 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:35 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19519695..19520293 1..600 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:35 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19519695..19520293 1..600 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:40 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19512795..19513393 1..600 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:33 Download gff for RT03811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19512795..19513393 1..600 99   Plus

RT03811.pep Sequence

Translation from 0 to 596

> RT03811.pep
MKSFSGGLFFALLVGASWAAPHGGHATSYSSVTKHEGPVHKSLGYGYDHD
VVSAYGGIYGHGYPSVGHSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQ
KSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVKKLGHAHH
PQVYHKGYGHGDIYDADYGYGHDVAQYGGYGYGHGGHASSYVSVKQLH*

RT03811.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23679-PA 196 GF23679-PA 1..196 1..198 782 85.9 Plus
Dana\GF10753-PA 201 GF10753-PA 94..187 86..196 308 61.3 Plus
Dana\GF24956-PA 188 GF24956-PA 52..117 81..146 256 74.2 Plus
Dana\GF10287-PA 375 GF10287-PA 19..121 59..162 256 56.2 Plus
Dana\GF10288-PA 157 GF10288-PA 82..144 84..146 227 71.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16039-PA 198 GG16039-PA 1..198 1..198 865 93.4 Plus
Dere\GG13400-PA 195 GG13400-PA 22..181 21..196 291 43.9 Plus
Dere\GG14555-PA 180 GG14555-PA 19..114 56..146 253 57.7 Plus
Dere\GG14302-PA 162 GG14302-PA 87..149 84..146 227 71.4 Plus
Dere\GG14206-PA 148 GG14206-PA 6..128 28..144 216 40.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17178-PA 200 GH17178-PA 1..200 1..198 555 68.3 Plus
Dgri\GH14395-PA 191 GH14395-PA 7..157 8..149 300 46.8 Plus
Dgri\GH17176-PA 192 GH17176-PA 7..157 8..149 300 46.8 Plus
Dgri\GH15041-PA 182 GH15041-PA 1..114 1..144 256 50 Plus
Dgri\GH15052-PA 136 GH15052-PA 45..110 79..144 246 72.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr76Bb-PA 198 CG9290-PA 1..198 1..198 1124 100 Plus
Cpr76Ba-PA 204 CG9283-PA 15..190 14..196 391 43.9 Plus
Cpr62Bc-PB 180 CG1919-PB 19..119 56..155 286 55.7 Plus
Cpr62Bc-PA 180 CG1919-PA 19..119 56..155 286 55.7 Plus
Cpr66Cb-PA 162 CG7076-PA 11..159 11..156 279 43.4 Plus
Cpr35B-PA 218 CG3474-PA 9..197 10..198 279 37.7 Plus
CG34461-PB 138 CG34461-PB 22..110 60..144 262 59.6 Plus
CG34461-PA 138 CG34461-PA 22..110 60..144 262 59.6 Plus
Cpr76Bc-PD 424 CG9295-PD 46..121 77..151 238 59.2 Plus
Cpr76Bc-PC 424 CG9295-PC 46..121 77..151 238 59.2 Plus
Cpr62Bb-PC 194 CG13935-PC 15..101 63..152 233 55.6 Plus
Cpr62Bb-PB 194 CG13935-PB 15..101 63..152 233 55.6 Plus
Cpr62Bb-PA 194 CG13935-PA 15..101 63..152 233 55.6 Plus
Ccp84Ac-PA 217 CG1327-PA 47..134 68..153 224 51.1 Plus
Cpr92A-PA 245 CG6240-PA 14..126 54..144 222 45.1 Plus
Cpr64Aa-PA 192 CG15006-PA 50..120 74..146 208 57.5 Plus
Ccp84Aa-PA 205 CG2360-PA 37..120 59..144 208 48.8 Plus
Crys-PB 477 CG16963-PB 75..135 84..144 207 65.6 Plus
Crys-PA 477 CG16963-PA 75..135 84..144 207 65.6 Plus
Ccp84Ag-PA 191 CG2342-PA 34..100 76..144 205 55.1 Plus
Ccp84Ab-PA 221 CG1252-PA 37..120 59..144 205 48.8 Plus
Cpr64Ab-PA 120 CG15007-PA 37..100 79..144 203 62.1 Plus
Cpr64Ad-PB 247 CG1259-PB 143..204 83..144 202 62.9 Plus
Cpr5C-PA 145 CG4052-PA 56..122 76..144 200 56.5 Plus
Edg84A-PA 188 CG2345-PA 25..95 69..144 200 53.9 Plus
Cpr31A-PA 340 CG33302-PA 133..193 84..144 199 63.9 Plus
Ccp84Af-PA 151 CG1331-PA 54..125 76..149 198 52.7 Plus
Cpr64Ac-PA 188 CG15008-PA 90..154 84..148 193 63.1 Plus
Ccp84Ad-PA 199 CG2341-PA 54..120 76..144 193 53.6 Plus
Cpr30F-PA 146 CG31876-PA 45..103 86..144 192 59.3 Plus
Cpr76Bd-PD 1228 CG9299-PD 1042..1209 5..142 192 34.3 Plus
Cpr76Bd-PB 1228 CG9299-PB 1042..1209 5..142 192 34.3 Plus
Cpr76Bd-PC 1231 CG9299-PC 1045..1212 5..142 192 34.3 Plus
Cpr30B-PA 153 CG3818-PA 25..91 79..144 191 55.2 Plus
Cpr23B-PA 302 CG2973-PA 148..219 79..148 181 54.2 Plus
Ccp84Ae-PA 208 CG1330-PA 46..109 79..144 178 53 Plus
CG13670-PA 266 CG13670-PA 101..179 84..169 172 46.5 Plus
CG42367-PC 103 CG42367-PC 38..97 85..144 162 51.7 Plus
Cpr50Cb-PA 178 CG6305-PA 90..178 86..182 141 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11790-PA 250 GI11790-PA 70..250 21..198 516 69.8 Plus
Dmoj\GI13522-PA 185 GI13522-PA 7..178 8..196 343 48.7 Plus
Dmoj\GI12933-PA 163 GI12933-PA 26..125 57..155 258 56.4 Plus
Dmoj\GI12819-PA 389 GI12819-PA 61..142 79..162 258 64.3 Plus
Dmoj\GI11675-PA 176 GI11675-PA 50..113 81..144 250 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20937-PA 198 GL20937-PA 1..198 1..198 732 82.2 Plus
Dper\GL20893-PA 214 GL20893-PA 8..200 8..196 320 45.8 Plus
Dper\GL24692-PA 133 GL24692-PA 24..114 55..155 257 54.5 Plus
Dper\GL24822-PA 183 GL24822-PA 48..119 81..156 246 64.5 Plus
Dper\GL24694-PA 159 GL24694-PA 6..146 8..146 227 46.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21674-PA 198 GA21674-PA 1..198 1..198 732 82.2 Plus
Dpse\GA21668-PA 214 GA21668-PA 8..200 8..196 323 45.3 Plus
Dpse\GA23954-PA 133 GA23954-PA 24..114 55..155 257 54.5 Plus
Dpse\GA15131-PA 183 GA15131-PA 48..119 81..156 254 65.8 Plus
Dpse\GA20083-PA 159 GA20083-PA 6..146 8..146 227 46.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19580-PA 198 GM19580-PA 1..198 1..198 874 96 Plus
Dsec\GM18103-PA 205 GM18103-PA 8..191 8..196 333 45.3 Plus
Dsec\GM14163-PA 180 GM14163-PA 49..114 81..146 252 74.2 Plus
Dsec\GM25044-PA 162 GM25044-PA 87..149 84..146 228 71.4 Plus
Dsec\GM13998-PA 147 GM13998-PA 6..127 28..144 217 39.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14807-PA 198 GD14807-PA 1..198 1..198 947 97 Plus
Dsim\GD12275-PA 205 GD12275-PA 8..191 8..196 332 45.3 Plus
Dsim\GD13434-PA 180 GD13434-PA 49..114 81..146 251 74.2 Plus
Dsim\GD14078-PA 177 GD14078-PA 60..149 59..144 242 56.7 Plus
Dsim\GD14081-PA 162 GD14081-PA 87..149 84..146 227 71.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13494-PA 198 GJ13494-PA 1..198 1..198 569 69.8 Plus
Dvir\GJ11882-PA 187 GJ11882-PA 8..180 8..196 357 49.5 Plus
Dvir\GJ12945-PA 178 GJ12945-PA 32..112 64..144 260 63 Plus
Dvir\GJ12961-PA 135 GJ12961-PA 44..131 79..163 257 60.2 Plus
Dvir\GJ12963-PA 164 GJ12963-PA 6..148 8..146 229 45.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19436-PA 266 GK19436-PA 1..184 1..194 467 61.3 Plus
Dwil\GK11910-PA 389 GK11910-PA 20..150 59..182 262 48.5 Plus
Dwil\GK20563-PA 184 GK20563-PA 48..111 81..144 253 75 Plus
Dwil\GK11921-PA 158 GK11921-PA 6..145 8..146 231 42.2 Plus
Dwil\GK20564-PA 195 GK20564-PA 17..101 65..152 222 56.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23205-PA 198 GE23205-PA 1..198 1..198 876 94.4 Plus
Dyak\GE19605-PA 195 GE19605-PA 1..195 1..198 834 92.4 Plus
Dyak\GE22774-PA 208 GE22774-PA 8..194 8..196 279 44.8 Plus
Dyak\GE22495-PA 208 GE22495-PA 8..194 8..196 275 44.8 Plus
Dyak\GE20909-PA 180 GE20909-PA 49..114 81..146 252 74.2 Plus

RT03811.hyp Sequence

Translation from 1 to 596

> RT03811.hyp
MKSFSGGLFFALLVGASWAAPHGGHATSYSSVTKHEGPVHKSLGYGYDHD
VVSAYGGIYGHGYPSVGHSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQ
KSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVKKLGHAHH
PQVYHKGYGHGDIYDADYGYGHDVAQYGGYGYGHGGHASSYVSVKQLH*

RT03811.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr76Bb-PA 198 CG9290-PA 1..198 1..198 1124 100 Plus
Cpr76Ba-PA 204 CG9283-PA 15..190 14..196 391 43.9 Plus
Cpr62Bc-PB 180 CG1919-PB 19..119 56..155 286 55.7 Plus
Cpr62Bc-PA 180 CG1919-PA 19..119 56..155 286 55.7 Plus
Cpr66Cb-PA 162 CG7076-PA 11..159 11..156 279 43.4 Plus