Clone RT03845 Report

Search the DGRC for RT03845

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:38
Well:45
Vector:pCR2.1
Associated Gene/TranscriptSkpC-RA
Protein status:RT03845.pep: gold
Sequenced Size:480

Clone Sequence Records

RT03845.complete Sequence

480 bp assembled on 2009-12-10

GenBank Submission: BT120007.1

> RT03845.complete
ATGGATGCTCCCACCATCAAGCTTGAGTCCTCGGATGGGATGATCTTTTC
AACGGAAGTCCGAGCCGCCAAGCTCTCCGAAACCATCAAGACCATGTTGG
AGGTCTCTGCCGTGGAGAACGACGAGAATGCCATTGTGCCGCTGCCCAAG
GTGAACGCGTTCATCCTATCCAAGATTCTGACCTGGATCTATCACCACAA
GGACGATGATGCCCATGGAGCGGAGGGCGTGGAGTTGAGCCCGCAAAGCC
CACATGACATCTCAGCCTGGGACGCCAACTTTATTAACGTCGATCAACCC
ACCTTGTTCGAAATCATACTGGCCGCCAACTATCTGGAGATCAAGGGCCT
AGTGGATCTCTGTTGCAAGACGGTGGCCAATATGATTAGGGGAAAGACTC
CCGAGGAGATCCGCCACACGTTCAACATCCCGGACGAAATACCGAGCAGG
ACGGCCCAGTTGGGCGAAGACCTGTGACAC

RT03845.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
skpC-RA 477 skpC-RA 1..477 1..477 2385 100 Plus
skpD-RA 660 skpD-RA 73..549 1..477 1905 93.2 Plus
skpE-RA 713 skpE-RA 82..515 1..434 970 81.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19704804..19705280 1..477 2385 100 Plus
chrX 22417052 chrX 19701465..19701941 1..477 1905 93.3 Plus
chrX 22417052 chrX 19712229..19712662 434..1 970 81.6 Minus
chrX 22417052 chrX 551388..551500 316..428 250 81.4 Plus
chrX 22417052 chrX 551085..551230 10..155 235 77.4 Plus
chr2R 21145070 chr2R 8026710..8026886 430..254 210 74.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19816138..19816614 1..477 2385 100 Plus
X 23542271 X 19812801..19813277 1..477 1905 93.3 Plus
X 23542271 X 19823566..19823999 434..1 970 81.6 Minus
X 23542271 X 657416..657528 316..428 250 81.4 Plus
X 23542271 X 657113..657258 10..155 235 77.4 Plus
2R 25286936 2R 12139507..12139683 430..254 210 74.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19824236..19824712 1..477 2385 100 Plus
X 23527363 X 19820899..19821375 1..477 1905 93.2 Plus
X 23527363 X 19831664..19832097 434..1 970 81.5 Minus
X 23527363 X 665514..665626 316..428 250 81.4 Plus
X 23527363 X 665211..665356 10..155 235 77.3 Plus
Blast to na_te.dros performed on 2019-03-15 19:57:25 has no hits.

RT03845.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:58:13 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19704804..19705283 1..480 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:05:26 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
skpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:27:10 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
skpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:17:02 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
skpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:17 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
SkpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:05:26 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
skpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:27:10 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
skpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:17:02 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
skpC-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:17 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
SkpC-RA 67..546 1..480 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:13 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
X 19816138..19816617 1..480 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:13 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
X 19816138..19816617 1..480 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:13 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
X 19816138..19816617 1..480 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:17:02 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19710171..19710650 1..480 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:32 Download gff for RT03845.complete
Subject Subject Range Query Range Percent Splice Strand
X 19824236..19824715 1..480 99   Plus

RT03845.pep Sequence

Translation from 0 to 476

> RT03845.pep
MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPK
VNAFILSKILTWIYHHKDDDAHGAEGVELSPQSPHDISAWDANFINVDQP
TLFEIILAANYLEIKGLVDLCCKTVANMIRGKTPEEIRHTFNIPDEIPSR
TAQLGEDL*

RT03845.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21176-PA 248 GF21176-PA 5..153 6..154 432 60 Plus
Dana\GF11136-PA 161 GF11136-PA 2..143 4..147 387 54.9 Plus
Dana\GF12644-PA 161 GF12644-PA 2..143 4..147 386 55.6 Plus
Dana\GF11848-PA 179 GF11848-PA 2..162 4..157 379 48.4 Plus
Dana\GF21823-PA 200 GF21823-PA 2..133 6..126 154 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19259-PA 157 GG19259-PA 1..157 1..158 471 61.4 Plus
Dere\GG12805-PA 162 GG12805-PA 2..152 4..154 453 60.5 Plus
Dere\GG20030-PA 170 GG20030-PA 2..144 4..147 391 52.8 Plus
Dere\GG22608-PA 162 GG22608-PA 2..151 4..154 388 53.9 Plus
Dere\GG20001-PA 160 GG20001-PA 2..145 6..149 149 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19712-PA 162 GH19712-PA 2..152 4..154 444 58.6 Plus
Dgri\GH24518-PA 162 GH24518-PA 2..152 4..154 442 58.6 Plus
Dgri\GH20861-PA 162 GH20861-PA 2..146 4..149 376 50.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
SkpC-PA 158 CG11941-PA 1..158 1..158 815 100 Plus
SkpD-PA 158 CG12700-PA 1..158 1..158 705 85.4 Plus
SkpE-PA 167 CG11942-PA 1..155 1..154 469 62.6 Plus
SkpA-PI 162 CG16983-PI 2..155 4..157 445 59.4 Plus
SkpA-PH 162 CG16983-PH 2..155 4..157 445 59.4 Plus
SkpA-PA 162 CG16983-PA 2..155 4..157 445 59.4 Plus
SkpA-PD 162 CG16983-PD 2..155 4..157 445 59.4 Plus
SkpA-PG 162 CG16983-PG 2..155 4..157 445 59.4 Plus
SkpA-PB 162 CG16983-PB 2..155 4..157 445 59.4 Plus
SkpA-PC 162 CG16983-PC 2..155 4..157 445 59.4 Plus
SkpA-PF 162 CG16983-PF 2..155 4..157 445 59.4 Plus
SkpA-PE 162 CG16983-PE 2..155 4..157 445 59.4 Plus
SkpB-PA 161 CG8881-PA 2..154 4..157 374 51.6 Plus
SkpF-PA 171 CG12227-PA 2..143 4..146 374 51.7 Plus
CG15800-PA 157 CG15800-PA 2..133 6..135 155 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15084-PA 162 GI15084-PA 2..152 4..154 446 59.2 Plus
Dmoj\GI20969-PA 162 GI20969-PA 2..152 4..154 389 52 Plus
Dmoj\GI11198-PA 148 GI11198-PA 4..139 6..143 345 51.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13359-PA 162 GL13359-PA 2..152 4..154 451 60.5 Plus
Dper\GL13358-PA 162 GL13358-PA 2..152 4..154 451 60.5 Plus
Dper\GL14141-PA 162 GL14141-PA 2..152 4..154 451 60.5 Plus
Dper\GL15335-PA 162 GL15335-PA 2..152 4..154 451 59.9 Plus
Dper\GL16990-PA 162 GL16990-PA 2..152 4..154 395 55.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14255-PA 162 GA14255-PA 2..152 4..154 449 59.9 Plus
Dpse\GA21386-PA 162 GA21386-PA 2..152 4..154 398 56.2 Plus
Dpse\GA26756-PA 164 GA26756-PA 2..142 4..143 387 53.3 Plus
Dpse\GA26757-PA 164 GA26757-PA 2..142 4..143 355 50 Plus
Dpse\GA24828-PA 169 GA24828-PA 2..149 4..146 340 49.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22995-PA 168 GM22995-PA 12..168 2..158 570 71.3 Plus
Dsec\GM19084-PA 162 GM19084-PA 2..140 4..143 452 63.6 Plus
Dsec\GM20386-PA 161 GM20386-PA 2..151 4..154 383 52.6 Plus
Dsec\GM15542-PA 170 GM15542-PA 2..144 4..147 353 52.1 Plus
Dsec\GM22705-PA 110 GM22705-PA 1..53 1..53 167 69.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17469-PA 157 GD17469-PA 12..157 2..147 485 65.1 Plus
Dsim\GD16521-PA 162 GD16521-PA 2..140 4..143 452 63.6 Plus
Dsim\GD25859-PA 161 GD25859-PA 2..151 4..154 387 53.3 Plus
Dsim\GD25046-PA 170 GD25046-PA 2..144 4..147 353 52.1 Plus
Dsim\GD25861-PA 128 GD25861-PA 6..118 42..154 321 55.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18891-PA 200 GJ18891-PA 40..190 4..154 446 59.2 Plus
Dvir\GJ20688-PA 162 GJ20688-PA 2..152 4..154 377 50.7 Plus
Dvir\GJ18483-PA 150 GJ18483-PA 4..141 6..143 353 53.2 Plus
Dvir\GJ22314-PA 140 GJ22314-PA 2..137 4..156 292 46.4 Plus
Dvir\GJ18822-PA 145 GJ18822-PA 4..136 6..138 149 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16428-PA 162 GK16428-PA 2..140 4..143 451 63.6 Plus
Dwil\GK23055-PA 154 GK23055-PA 2..148 4..154 413 54.6 Plus
Dwil\GK21342-PA 161 GK21342-PA 2..151 4..154 401 53.9 Plus
Dwil\GK21211-PA 162 GK21211-PA 3..144 5..147 401 55.9 Plus
Dwil\GK10153-PA 166 GK10153-PA 2..155 4..158 387 52.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\skpA-PA 162 GE16631-PA 2..152 4..154 454 60.5 Plus
Dyak\GE13476-PA 162 GE13476-PA 2..151 4..154 383 53.3 Plus
Dyak\GE11566-PA 172 GE11566-PA 2..143 4..147 380 51.4 Plus
Dyak\GE11534-PA 194 GE11534-PA 31..179 1..149 147 27.8 Plus

RT03845.hyp Sequence

Translation from 1 to 476

> RT03845.hyp
MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPK
VNAFILSKILTWIYHHKDDDAHGAEGVELSPQSPHDISAWDANFINVDQP
TLFEIILAANYLEIKGLVDLCCKTVANMIRGKTPEEIRHTFNIPDEIPSR
TAQLGEDL*

RT03845.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
SkpC-PA 158 CG11941-PA 1..158 1..158 815 100 Plus
SkpD-PA 158 CG12700-PA 1..158 1..158 705 85.4 Plus
SkpE-PA 167 CG11942-PA 1..155 1..154 469 62.6 Plus
SkpA-PI 162 CG16983-PI 2..155 4..157 445 59.4 Plus
SkpA-PH 162 CG16983-PH 2..155 4..157 445 59.4 Plus