Clone RT03868 Report

Search the DGRC for RT03868

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:38
Well:68
Vector:pCR2.1
Associated Gene/Transcripttsg-RA
Protein status:RT03868.pep: gold
Sequenced Size:750

Clone Sequence Records

RT03868.complete Sequence

750 bp assembled on 2009-11-16

GenBank Submission: BT120366.1

> RT03868.complete
ATGCAGTTACTGTGCTACTTCGTCATCCTTTTCGTTGGAATCGCACCGTG
GTCATCCTTGGCCAACGATGATGGATGCAACGAAGTGGTCTGCGGATCGG
TGGTATCCAAGTGCCTCATCACCCAGAGCTGCCAGTGCAAGTTAAATGAC
TGCCACTGCTGCAAGGACTGTCTAAATTGCCTTGGCGAACTGTACATCGA
GTGCTGTGGCTGCCTCGACATGTGTCCCAAGCACAAGGATGTCCTGCCCT
CGCTGACGCCGCGCTCGGAGATTGGAGACATTGAAGGAGTGCCCGAGCTG
TTCGACACCCTAACCGCCGAGGATGACGAGGGATGGTCCACCATAAGGTT
CTCCATGCGAGCCGGCTTCAAGCAGCGCGTTCAGGGCGGCGCGAGTGGTG
ATGCCGGAAACGGAAATGGAAATGGAAATGCCGGGTCTGCAGGTGTCACC
CTATGCACCGTGATCTATGTGAACTCGTGCATTCGGGCAAACAAGTGCCG
GCAGCAGTGCGAGAGCATGGGAGCCAGTAGCTATCGATGGTTCCACGACG
GATGCTGCGAGTGCGTCGGCGAGAATTGCCTCAATTATGGAATCAACGAG
AGTCGCTGCCGCGGTTGTCCGGAGGATCAGGACCAACTGCTTACCGCCGA
TACCGTTCCGGCGGAGGCTGAACAGGATCTGGAGCGATTCTTTGGCAACG
AGGAGATCGAGGACGAGTGGGGCTATGGCGAGGAGGATGAATTTTCCTAA

RT03868.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
tsg-RA 751 tsg-RA 2..751 1..750 3750 100 Plus
cv-RA 1917 cv-RA 710..820 76..186 210 79.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11879252..11879999 748..1 3710 99.7 Minus
chrX 22417052 chrX 5583250..5583360 76..186 210 79.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11988163..11988912 750..1 3750 100 Minus
X 23542271 X 5690847..5690957 76..186 210 79.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11996261..11997010 750..1 3750 100 Minus
X 23527363 X 5698945..5699055 76..186 210 79.2 Plus
Blast to na_te.dros performed on 2019-03-16 21:30:35 has no hits.

RT03868.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:31:14 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11879250..11879999 1..750 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-16 13:03:50 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 1..748 1..748 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:27 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 1..750 1..750 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:00:11 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 1..750 1..750 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:21:28 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 1..750 1..750 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-16 13:03:49 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 2..749 1..748 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:27 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 2..751 1..750 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:00:11 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 37..786 1..750 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:21:28 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
tsg-RA 37..786 1..750 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:31:14 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
X 11988163..11988912 1..750 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:31:14 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
X 11988163..11988912 1..750 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:31:14 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
X 11988163..11988912 1..750 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:00:11 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11882196..11882945 1..750 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:50 Download gff for RT03868.complete
Subject Subject Range Query Range Percent Splice Strand
X 11996261..11997010 1..750 100   Minus

RT03868.pep Sequence

Translation from 0 to 749

> RT03868.pep
MQLLCYFVILFVGIAPWSSLANDDGCNEVVCGSVVSKCLITQSCQCKLND
CHCCKDCLNCLGELYIECCGCLDMCPKHKDVLPSLTPRSEIGDIEGVPEL
FDTLTAEDDEGWSTIRFSMRAGFKQRVQGGASGDAGNGNGNGNAGSAGVT
LCTVIYVNSCIRANKCRQQCESMGASSYRWFHDGCCECVGENCLNYGINE
SRCRGCPEDQDQLLTADTVPAEAEQDLERFFGNEEIEDEWGYGEEDEFS*

RT03868.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22285-PA 296 GF22285-PA 47..285 1..247 916 71.4 Plus
Dana\GF21369-PA 256 GF21369-PA 25..226 24..213 497 48.8 Plus
Dana\GF20091-PA 119 GF20091-PA 1..110 85..208 259 42.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18813-PA 251 GG18813-PA 1..251 1..249 1142 92.8 Plus
Dere\GG18776-PA 257 GG18776-PA 25..242 24..230 488 43.6 Plus
Dere\GG14197-PA 116 GG14197-PA 1..108 82..208 263 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11824-PA 243 GH11824-PA 18..239 21..245 848 73.7 Plus
Dgri\GH12675-PA 253 GH12675-PA 25..222 24..211 487 50.5 Plus
Dgri\GH15535-PA 150 GH15535-PA 26..143 82..208 264 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
tsg-PA 249 CG1502-PA 1..249 1..249 1397 100 Plus
cv-PC 257 CG12410-PC 25..242 24..230 540 43.2 Plus
cv-PB 257 CG12410-PB 25..242 24..230 540 43.2 Plus
cv-PA 257 CG12410-PA 25..242 24..230 540 43.2 Plus
srw-PB 136 CG11582-PB 21..128 82..208 286 42.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14766-PA 241 GI14766-PA 4..240 7..248 839 67.6 Plus
Dmoj\GI16252-PA 251 GI16252-PA 5..220 2..211 479 45 Plus
Dmoj\GI16812-PA 121 GI16812-PA 1..120 82..213 249 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18239-PA 258 GL18239-PA 25..246 24..233 489 44 Plus
Dper\GL17975-PA 100 GL17975-PA 29..91 146..208 238 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13438-PA 248 GA13438-PA 23..229 22..235 877 78.1 Plus
Dpse\GA11617-PA 258 GA11617-PA 25..246 24..233 491 44 Plus
Dpse\GA11080-PA 100 GA11080-PA 29..91 146..208 238 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13232-PA 247 GM13232-PA 1..247 1..249 1269 98 Plus
Dsec\GM12427-PA 254 GM12427-PA 25..239 24..230 481 43.2 Plus
Dsec\GM13987-PA 116 GM13987-PA 1..108 82..208 266 44.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15950-PA 247 GD15950-PA 1..247 1..249 1276 98.4 Plus
Dsim\GD16744-PA 257 GD16744-PA 25..242 24..230 488 43.6 Plus
Dsim\GD13268-PA 116 GD13268-PA 1..108 82..208 265 43.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18736-PA 239 GJ18736-PA 14..238 19..248 846 71.1 Plus
Dvir\GJ16717-PA 253 GJ16717-PA 25..222 24..211 491 50.5 Plus
Dvir\GJ12558-PA 123 GJ12558-PA 1..112 82..208 261 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20114-PA 240 GK20114-PA 2..239 1..248 812 63.9 Plus
Dwil\GK19749-PA 240 GK19749-PA 4..239 7..248 781 62.6 Plus
Dwil\GK19972-PA 251 GK19972-PA 25..223 24..209 474 47.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17577-PA 246 GE17577-PA 1..246 1..249 1171 93.6 Plus
Dyak\GE16419-PA 257 GE16419-PA 25..242 24..230 489 43.6 Plus
Dyak\GE20626-PA 116 GE20626-PA 1..108 82..208 271 42 Plus

RT03868.hyp Sequence

Translation from 1 to 747

> RT03868.hyp
MQLLCYFVILFVGIAPWSSLANDDGCNEVVCGSVVSKCLITQSCQCKLND
CHCCKDCLNCLGELYIECCGCLDMCPKHKDVLPSLTPRSEIGDIEGVPEL
FDTLTAEDDEGWSTIRFSMRAGFKQRVQGGASGDAGNGNGNGNAGSAGVT
LCTVIYVNSCIRANKCRQQCESMGASSYRWFHDGCCECVGENCLNYGINE
SRCRGCPEDQDQLLTADTVPAEAEQDLERFFGNEEIEDEWGYGEEDEFS

RT03868.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
tsg-PA 249 CG1502-PA 1..249 1..249 1397 100 Plus
cv-PC 257 CG12410-PC 25..242 24..230 540 43.2 Plus
cv-PB 257 CG12410-PB 25..242 24..230 540 43.2 Plus
cv-PA 257 CG12410-PA 25..242 24..230 540 43.2 Plus
srw-PB 136 CG11582-PB 21..128 82..208 286 42.7 Plus