Clone RT04001 Report

Search the DGRC for RT04001

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:40
Well:1
Vector:pCR2.1
Associated Gene/TranscriptIM14-RA
Protein status:RT04001.pep: gold
Sequenced Size:141

Clone Sequence Records

RT04001.complete Sequence

141 bp assembled on 2009-12-10

GenBank Submission: BT100325.1

> RT04001.complete
ATGAACTGTCTGAAGATCTGCGGCTTTTTCTTCGCTCTGATTGCGGCTTT
GGCGACGGCGGAGGCTGGCACCCAAGTCATTCATGCTGGCGGACACACGT
TGATTCAAACTGATCGCTCGCAGTATATACGCAAAAACTAA

RT04001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-RA 463 IM14-RA 191..331 1..141 705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16757079..16757151 67..139 365 100 Plus
chr2R 21145070 chr2R 16756949..16757016 1..68 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20870555..20870629 67..141 375 100 Plus
2R 25286936 2R 20870425..20870492 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20871754..20871828 67..141 375 100 Plus
2R 25260384 2R 20871624..20871691 1..68 340 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:17:34 has no hits.

RT04001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:36 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16756949..16757015 1..67 100 -> Plus
chr2R 16757080..16757153 68..141 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:18:37 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..139 1..139 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:30 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..141 1..141 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:39 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..141 1..141 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:04 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..141 1..141 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:18:36 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..139 1..139 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:30 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..141 1..141 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:39 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 34..174 1..141 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:04 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 34..174 1..141 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:36 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20870556..20870629 68..141 100   Plus
2R 20870425..20870491 1..67 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:36 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20870556..20870629 68..141 100   Plus
2R 20870425..20870491 1..67 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:36 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20870556..20870629 68..141 100   Plus
2R 20870425..20870491 1..67 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:39 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16757930..16757996 1..67 100 -> Plus
arm_2R 16758061..16758134 68..141 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:46 Download gff for RT04001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20871624..20871690 1..67 100 -> Plus
2R 20871755..20871828 68..141 100   Plus

RT04001.pep Sequence

Translation from 0 to 140

> RT04001.pep
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN*

RT04001.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-PA 46 CG33990-PA 1..46 1..46 238 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15780-PA 46 GM15780-PA 1..46 1..46 238 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11543-PA 46 GD11543-PA 1..46 1..46 238 100 Plus

RT04001.hyp Sequence

Translation from 1 to 138

> RT04001.hyp
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN

RT04001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-PA 46 CG33990-PA 1..46 1..46 238 100 Plus