RT04001.complete Sequence
141 bp assembled on 2009-12-10
GenBank Submission: BT100325.1
> RT04001.complete
ATGAACTGTCTGAAGATCTGCGGCTTTTTCTTCGCTCTGATTGCGGCTTT
GGCGACGGCGGAGGCTGGCACCCAAGTCATTCATGCTGGCGGACACACGT
TGATTCAAACTGATCGCTCGCAGTATATACGCAAAAACTAA
RT04001.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:46:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-RA | 463 | IM14-RA | 191..331 | 1..141 | 705 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:17:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 16757079..16757151 | 67..139 | 365 | 100 | Plus |
chr2R | 21145070 | chr2R | 16756949..16757016 | 1..68 | 340 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20870555..20870629 | 67..141 | 375 | 100 | Plus |
2R | 25286936 | 2R | 20870425..20870492 | 1..68 | 340 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 20871754..20871828 | 67..141 | 375 | 100 | Plus |
2R | 25260384 | 2R | 20871624..20871691 | 1..68 | 340 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:17:34 has no hits.
RT04001.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:36 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 16756949..16757015 | 1..67 | 100 | -> | Plus |
chr2R | 16757080..16757153 | 68..141 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:18:37 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..139 | 1..139 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:30 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..141 | 1..141 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:39 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..141 | 1..141 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:04 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..141 | 1..141 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:18:36 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..139 | 1..139 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:30 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..141 | 1..141 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:39 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 34..174 | 1..141 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:04 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 34..174 | 1..141 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:36 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20870556..20870629 | 68..141 | 100 | | Plus |
2R | 20870425..20870491 | 1..67 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:36 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20870556..20870629 | 68..141 | 100 | | Plus |
2R | 20870425..20870491 | 1..67 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:36 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20870556..20870629 | 68..141 | 100 | | Plus |
2R | 20870425..20870491 | 1..67 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:39 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16757930..16757996 | 1..67 | 100 | -> | Plus |
arm_2R | 16758061..16758134 | 68..141 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:46 Download gff for
RT04001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20871624..20871690 | 1..67 | 100 | -> | Plus |
2R | 20871755..20871828 | 68..141 | 100 | | Plus |
RT04001.pep Sequence
Translation from 0 to 140
> RT04001.pep
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN*
RT04001.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-PA | 46 | CG33990-PA | 1..46 | 1..46 | 238 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:08:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15780-PA | 46 | GM15780-PA | 1..46 | 1..46 | 238 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:08:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11543-PA | 46 | GD11543-PA | 1..46 | 1..46 | 238 | 100 | Plus |
RT04001.hyp Sequence
Translation from 1 to 138
> RT04001.hyp
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN
RT04001.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:16:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-PA | 46 | CG33990-PA | 1..46 | 1..46 | 238 | 100 | Plus |