Clone Sequence Records
RT04042.complete Sequence
411 bp assembled on 2010-06-22
GenBank Submission: BT100326.2
> RT04042.complete
ATGTTGGACCAACTTACACTGTGTTTGTTGCTAAATTTTCTGTGCGCAAA
TGTTCTCGCTAACACTTCAGTATTTAATCCGTGTGTTTCGCAAAATGAGT
TATCCGAATATGAAGCCCACCAAGTGATGGAGAATTGGCCAGTTCCGCCC
ATCGATCGGGCTTACAAATGCTTTCTAACATGCGTCCTCTTGGATTTGGG
TCTGATTGATGAACGGGGTAATGTGCAGATCGATAAGTACATGAAATCCG
GAGTGGTGGACTGGCAATGGGTGGCAATAGAGTTGGTAACATGTCGCATA
GAATTCAGCGACGAAAGGGATCTGTGCGAGCTATCATATGGAATCTTCAA
CTGCTTCAAGGATGTGAAGCTTGCGGCCGAGAAGTATGTTTCAATTAGTA
ATGCAAAGTAG
RT04042.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:39:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp57e-RA | 456 | Obp57e-RA | 46..456 | 1..411 | 2055 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:58:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 16434572..16434925 | 411..58 | 1710 | 98.9 | Minus |
chr2R | 21145070 | chr2R | 16434992..16435049 | 58..1 | 245 | 94.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:58:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20547816..20548169 | 411..58 | 1770 | 100 | Minus |
2R | 25286936 | 2R | 20548234..20548291 | 58..1 | 290 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 20549015..20549368 | 411..58 | 1770 | 100 | Minus |
2R | 25260384 | 2R | 20549433..20549490 | 58..1 | 290 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 03:58:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
baggins | 5453 | baggins BAGGINS 5453bp | 3939..3981 | 273..315 | 107 | 72.1 | Plus |
RT04042.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:59:35 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 16434572..16434925 | 58..411 | 98 | <- | Minus |
chr2R | 16434993..16435049 | 1..57 | 94 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-22 15:08:59 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:59:57 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:41 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:27 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-22 15:08:58 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:59:57 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:41 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:27 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57e-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:35 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20547816..20548169 | 58..411 | 100 | <- | Minus |
2R | 20548235..20548291 | 1..57 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:35 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20547816..20548169 | 58..411 | 100 | <- | Minus |
2R | 20548235..20548291 | 1..57 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:35 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20547816..20548169 | 58..411 | 100 | <- | Minus |
2R | 20548235..20548291 | 1..57 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:41 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16435321..16435674 | 58..411 | 100 | <- | Minus |
arm_2R | 16435740..16435796 | 1..57 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:37:31 Download gff for
RT04042.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20549015..20549368 | 58..411 | 100 | <- | Minus |
2R | 20549434..20549490 | 1..57 | 100 | | Minus |
RT04042.pep Sequence
Translation from 0 to 410
> RT04042.pep
MLDQLTLCLLLNFLCANVLANTSVFNPCVSQNELSEYEAHQVMENWPVPP
IDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVAIELVTCRI
EFSDERDLCELSYGIFNCFKDVKLAAEKYVSISNAK*
RT04042.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:08:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\Obp57d-PA | 118 | GF19810-PA | 2..105 | 21..120 | 225 | 36.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:08:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20856-PA | 136 | GG20856-PA | 1..136 | 1..136 | 545 | 74.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp57e-PA | 136 | CG30145-PA | 1..136 | 1..136 | 725 | 100 | Plus |
Obp57d-PB | 136 | CG30150-PB | 31..129 | 26..120 | 172 | 32.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:08:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\Obp57de-PA | 133 | GA15675-PA | 21..130 | 20..126 | 208 | 32.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\Obp57e-PA | 136 | GM19783-PA | 1..136 | 1..136 | 659 | 93.4 | Plus |
Dsec\Obp57d-PA | 135 | GM19782-PA | 26..134 | 21..125 | 174 | 32.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Obp57e-PA | 136 | GD25275-PA | 15..136 | 15..136 | 610 | 94.3 | Plus |
Dsim\Obp57d-PA | 135 | GD25274-PA | 31..134 | 26..125 | 174 | 32.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:08:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19324-PA | 104 | GK19324-PA | 1..98 | 23..118 | 162 | 34 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:08:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\Obp57e-PA | 137 | GE13796-PA | 1..137 | 1..136 | 591 | 79.6 | Plus |
Dyak\Obp57d-PA | 133 | GE13795-PA | 6..126 | 4..120 | 199 | 28.9 | Plus |
RT04042.hyp Sequence
Translation from 1 to 410
> RT04042.hyp
MLDQLTLCLLLNFLCANVLANTSVFNPCVSQNELSEYEAHQVMENWPVPP
IDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVAIELVTCRI
EFSDERDLCELSYGIFNCFKDVKLAAEKYVSISNAK*
RT04042.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp57e-PA | 136 | CG30145-PA | 1..136 | 1..136 | 725 | 100 | Plus |
Obp57d-PB | 136 | CG30150-PB | 31..129 | 26..120 | 172 | 32.3 | Plus |