Clone RT04042 Report

Search the DGRC for RT04042

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:40
Well:42
Vector:pCR2.1
Associated Gene/TranscriptObp57e-RA
Protein status:RT04042.pep: gold
Sequenced Size:411

Clone Sequence Records

RT04042.complete Sequence

411 bp assembled on 2010-06-22

GenBank Submission: BT100326.2

> RT04042.complete
ATGTTGGACCAACTTACACTGTGTTTGTTGCTAAATTTTCTGTGCGCAAA
TGTTCTCGCTAACACTTCAGTATTTAATCCGTGTGTTTCGCAAAATGAGT
TATCCGAATATGAAGCCCACCAAGTGATGGAGAATTGGCCAGTTCCGCCC
ATCGATCGGGCTTACAAATGCTTTCTAACATGCGTCCTCTTGGATTTGGG
TCTGATTGATGAACGGGGTAATGTGCAGATCGATAAGTACATGAAATCCG
GAGTGGTGGACTGGCAATGGGTGGCAATAGAGTTGGTAACATGTCGCATA
GAATTCAGCGACGAAAGGGATCTGTGCGAGCTATCATATGGAATCTTCAA
CTGCTTCAAGGATGTGAAGCTTGCGGCCGAGAAGTATGTTTCAATTAGTA
ATGCAAAGTAG

RT04042.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57e-RA 456 Obp57e-RA 46..456 1..411 2055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16434572..16434925 411..58 1710 98.9 Minus
chr2R 21145070 chr2R 16434992..16435049 58..1 245 94.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20547816..20548169 411..58 1770 100 Minus
2R 25286936 2R 20548234..20548291 58..1 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20549015..20549368 411..58 1770 100 Minus
2R 25260384 2R 20549433..20549490 58..1 290 100 Minus
Blast to na_te.dros performed 2019-03-16 03:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 3939..3981 273..315 107 72.1 Plus

RT04042.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:59:35 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16434572..16434925 58..411 98 <- Minus
chr2R 16434993..16435049 1..57 94   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-22 15:08:59 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:59:57 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:41 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:27 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-22 15:08:58 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:59:57 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:41 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:27 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57e-RA 1..411 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:35 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20547816..20548169 58..411 100 <- Minus
2R 20548235..20548291 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:35 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20547816..20548169 58..411 100 <- Minus
2R 20548235..20548291 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:35 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20547816..20548169 58..411 100 <- Minus
2R 20548235..20548291 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:41 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16435321..16435674 58..411 100 <- Minus
arm_2R 16435740..16435796 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:37:31 Download gff for RT04042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20549015..20549368 58..411 100 <- Minus
2R 20549434..20549490 1..57 100   Minus

RT04042.pep Sequence

Translation from 0 to 410

> RT04042.pep
MLDQLTLCLLLNFLCANVLANTSVFNPCVSQNELSEYEAHQVMENWPVPP
IDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVAIELVTCRI
EFSDERDLCELSYGIFNCFKDVKLAAEKYVSISNAK*

RT04042.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Obp57d-PA 118 GF19810-PA 2..105 21..120 225 36.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20856-PA 136 GG20856-PA 1..136 1..136 545 74.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57e-PA 136 CG30145-PA 1..136 1..136 725 100 Plus
Obp57d-PB 136 CG30150-PB 31..129 26..120 172 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp57de-PA 133 GA15675-PA 21..130 20..126 208 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Obp57e-PA 136 GM19783-PA 1..136 1..136 659 93.4 Plus
Dsec\Obp57d-PA 135 GM19782-PA 26..134 21..125 174 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp57e-PA 136 GD25275-PA 15..136 15..136 610 94.3 Plus
Dsim\Obp57d-PA 135 GD25274-PA 31..134 26..125 174 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19324-PA 104 GK19324-PA 1..98 23..118 162 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Obp57e-PA 137 GE13796-PA 1..137 1..136 591 79.6 Plus
Dyak\Obp57d-PA 133 GE13795-PA 6..126 4..120 199 28.9 Plus

RT04042.hyp Sequence

Translation from 1 to 410

> RT04042.hyp
MLDQLTLCLLLNFLCANVLANTSVFNPCVSQNELSEYEAHQVMENWPVPP
IDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVAIELVTCRI
EFSDERDLCELSYGIFNCFKDVKLAAEKYVSISNAK*

RT04042.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57e-PA 136 CG30145-PA 1..136 1..136 725 100 Plus
Obp57d-PB 136 CG30150-PB 31..129 26..120 172 32.3 Plus