Clone RT04060 Report

Search the DGRC for RT04060

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:40
Well:60
Vector:pCR2.1
Associated Gene/TranscriptDup99B-RA
Protein status:RT04060.pep: gold
Sequenced Size:165

Clone Sequence Records

RT04060.complete Sequence

165 bp assembled on 2009-12-10

GenBank Submission: BT100330.1

> RT04060.complete
ATGAAGACTCCGCTATTTCTCCTCTTGGTCGTATTGGCTTCCCTCCTGGG
ATTGGCCTTATCCCAGGATCGAAATGATACGGAGTGGATCCAAAGTCAGA
AGGATCGTGAGAAGTGGTGCCGGCTAAACTTAGGACCCTACCTCGGTGGC
AGATGCCGAAAATAA

RT04060.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-RA 472 Dup99B-RA 155..319 1..165 825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25537831..25537945 115..1 560 99.1 Minus
chr3R 27901430 chr3R 25537730..25537786 163..107 285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29715235..29715349 115..1 560 99.1 Minus
3R 32079331 3R 29715132..29715190 165..107 295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29456066..29456180 115..1 560 99.1 Minus
3R 31820162 3R 29455963..29456021 165..107 295 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:58:36 has no hits.

RT04060.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:32 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25537840..25537945 1..106 100   Minus
chr3R 25537728..25537786 107..165 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:18:33 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 1..163 1..163 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:28 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 1..165 1..165 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:03:59 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 1..165 1..165 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:01 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 1..165 1..165 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:18:32 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 83..245 1..163 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:28 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..193 1..165 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:03:59 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..193 1..165 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:01 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..193 1..165 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:32 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29715132..29715190 107..165 100 <- Minus
3R 29715244..29715349 1..106 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:32 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29715132..29715190 107..165 100 <- Minus
3R 29715244..29715349 1..106 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:32 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29715132..29715190 107..165 100 <- Minus
3R 29715244..29715349 1..106 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:03:59 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25540854..25540912 107..165 100 <- Minus
arm_3R 25540966..25541071 1..106 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:44 Download gff for RT04060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29455963..29456021 107..165 100 <- Minus
3R 29456075..29456180 1..106 100   Minus

RT04060.pep Sequence

Translation from 0 to 164

> RT04060.pep
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRK*

RT04060.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-PA 54 CG33495-PA 1..54 1..54 286 100 Plus
Dup99B-PB 37 CG33495-PB 1..37 1..37 182 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12229-PA 52 GM12229-PA 1..52 1..52 178 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17687-PA 52 GD17687-PA 1..52 1..52 163 86.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10438-PA 54 GE10438-PA 1..54 1..54 167 72.2 Plus

RT04060.hyp Sequence

Translation from 1 to 162

> RT04060.hyp
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRK

RT04060.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-PA 54 CG33495-PA 1..54 1..54 286 100 Plus
Dup99B-PB 37 CG33495-PB 1..37 1..37 182 100 Plus