RT04060.complete Sequence
165 bp assembled on 2009-12-10
GenBank Submission: BT100330.1
> RT04060.complete
ATGAAGACTCCGCTATTTCTCCTCTTGGTCGTATTGGCTTCCCTCCTGGG
ATTGGCCTTATCCCAGGATCGAAATGATACGGAGTGGATCCAAAGTCAGA
AGGATCGTGAGAAGTGGTGCCGGCTAAACTTAGGACCCTACCTCGGTGGC
AGATGCCGAAAATAA
RT04060.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:46:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dup99B-RA | 472 | Dup99B-RA | 155..319 | 1..165 | 825 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:58:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 25537831..25537945 | 115..1 | 560 | 99.1 | Minus |
chr3R | 27901430 | chr3R | 25537730..25537786 | 163..107 | 285 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:58:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29715235..29715349 | 115..1 | 560 | 99.1 | Minus |
3R | 32079331 | 3R | 29715132..29715190 | 165..107 | 295 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 29456066..29456180 | 115..1 | 560 | 99.1 | Minus |
3R | 31820162 | 3R | 29455963..29456021 | 165..107 | 295 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 21:58:36 has no hits.
RT04060.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:32 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 25537840..25537945 | 1..106 | 100 | | Minus |
chr3R | 25537728..25537786 | 107..165 | 100 | <- | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:18:33 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 1..163 | 1..163 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:28 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 1..165 | 1..165 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:03:59 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 1..165 | 1..165 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:01 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 1..165 | 1..165 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:18:32 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 83..245 | 1..163 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:28 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 29..193 | 1..165 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:03:59 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 29..193 | 1..165 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:01 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 29..193 | 1..165 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:32 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29715132..29715190 | 107..165 | 100 | <- | Minus |
3R | 29715244..29715349 | 1..106 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:32 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29715132..29715190 | 107..165 | 100 | <- | Minus |
3R | 29715244..29715349 | 1..106 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:32 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29715132..29715190 | 107..165 | 100 | <- | Minus |
3R | 29715244..29715349 | 1..106 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:03:59 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25540854..25540912 | 107..165 | 100 | <- | Minus |
arm_3R | 25540966..25541071 | 1..106 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:44 Download gff for
RT04060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29455963..29456021 | 107..165 | 100 | <- | Minus |
3R | 29456075..29456180 | 1..106 | 100 | | Minus |
RT04060.pep Sequence
Translation from 0 to 164
> RT04060.pep
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRK*
RT04060.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dup99B-PA | 54 | CG33495-PA | 1..54 | 1..54 | 286 | 100 | Plus |
Dup99B-PB | 37 | CG33495-PB | 1..37 | 1..37 | 182 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:08:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12229-PA | 52 | GM12229-PA | 1..52 | 1..52 | 178 | 90.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:08:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17687-PA | 52 | GD17687-PA | 1..52 | 1..52 | 163 | 86.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:08:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10438-PA | 54 | GE10438-PA | 1..54 | 1..54 | 167 | 72.2 | Plus |
RT04060.hyp Sequence
Translation from 1 to 162
> RT04060.hyp
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRK
RT04060.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:47:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dup99B-PA | 54 | CG33495-PA | 1..54 | 1..54 | 286 | 100 | Plus |
Dup99B-PB | 37 | CG33495-PB | 1..37 | 1..37 | 182 | 100 | Plus |