Clone RT04080 Report

Search the DGRC for RT04080

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:40
Well:80
Vector:pCR2.1
Associated Gene/TranscriptSfp77F-RA
Protein status:RT04080.pep: gold
Sequenced Size:249

Clone Sequence Records

RT04080.complete Sequence

249 bp assembled on 2009-12-10

GenBank Submission: BT100328.1

> RT04080.complete
ATGAGAAAGGTCGTGTTAATTTGCTTACTAGCGAGATTTAGCATCGGATT
TCCCCAGGCTCACATATACAAGCCACTTCTTTGTGAGGAAACCAATGCTA
ATATAACCAGATCTTCGCTTCTTGCACAATGTGTAAATCAGGACGAATGT
TTTATAAACAGACCAGTAGGTCTATGCCCCAAACTTGAAGTTTGCTGCGT
TAAAAAACAAGATTTTAACATTGACGAGGTTGAATATATGGAAGATTAA

RT04080.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp77F-RA 404 Sfp77F-RA 38..286 1..249 1245 100 Plus
Sfp77F.a 1093 Sfp77F.a 20..268 1..249 1245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20886116..20886283 247..80 840 100 Minus
chr3L 24539361 chr3L 20886341..20886419 79..1 395 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20897093..20897262 249..80 850 100 Minus
3L 28110227 3L 20897320..20897398 79..1 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20890193..20890362 249..80 850 100 Minus
3L 28103327 3L 20890420..20890498 79..1 395 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:47:44 has no hits.

RT04080.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:48:42 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20886114..20886283 80..249 100 <- Minus
chr3L 20886341..20886419 1..79 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 11:27:35 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 1..247 1..247 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:31 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:35 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:27 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 11:27:35 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 1..247 1..247 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:31 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:35 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 20..268 1..249 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:27 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp77F-RA 20..268 1..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:42 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20897093..20897262 80..249 100 <- Minus
3L 20897320..20897398 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:42 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20897093..20897262 80..249 100 <- Minus
3L 20897320..20897398 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:42 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20897093..20897262 80..249 100 <- Minus
3L 20897320..20897398 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:35 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20890420..20890498 1..79 100   Minus
arm_3L 20890193..20890362 80..249 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:47 Download gff for RT04080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20890193..20890362 80..249 100 <- Minus
3L 20890420..20890498 1..79 100   Minus

RT04080.pep Sequence

Translation from 0 to 248

> RT04080.pep
MRKVVLICLLARFSIGFPQAHIYKPLLCEETNANITRSSLLAQCVNQDEC
FINRPVGLCPKLEVCCVKKQDFNIDEVEYMED*

RT04080.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp77F-PB 82 CG42482-PB 1..82 1..82 439 100 Plus
Sfp77F-PA 82 CG42482-PA 1..82 1..82 439 100 Plus

RT04080.hyp Sequence

Translation from 1 to 246

> RT04080.hyp
MRKVVLICLLARFSIGFPQAHIYKPLLCEETNANITRSSLLAQCVNQDEC
FINRPVGLCPKLEVCCVKKQDFNIDEVEYMED

RT04080.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp77F-PB 82 CG42482-PB 1..82 1..82 439 100 Plus
Sfp77F-PA 82 CG42482-PA 1..82 1..82 439 100 Plus