Clone RT04180 Report

Search the DGRC for RT04180

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:41
Well:80
Vector:pCR2.1
Associated Gene/TranscriptETH-RA
Protein status:RT04180.pep: gold
Sequenced Size:612

Clone Sequence Records

RT04180.complete Sequence

612 bp assembled on 2009-12-10

GenBank Submission: BT120013.1

> RT04180.complete
ATGAGAATCATAACAGTCCTGTCTGTTTCGCTCTTGGTGGGTCTTGTGGC
CATAAGCCAGGCAGACGACAGTAGTCCAGGATTCTTCCTAAAGATCACCA
AGAACGTACCGCGGCTGGGCAAGCGAGGCGAGAACTTTGCCATAAAGAAC
CTAAAGACCATTCCTCGCATAGGACGCAGTGAGCACAGCTCTGTTACTCC
TCTGCTGGCGTGGCTATGGGATTTGGAAACGAGTCCAAGCAAGCGGCGCT
TACCCGCAGGGGAATCCCCAGCGAAGGAGCAGGAACTTAACGTGGTGCAG
CCCGTCAACTCGAATACGCTCCTTGAGCTGCTTGACAACAACGCTATTCC
CAGCGAGCAGGTGAAGTTCGTCCACTGGAAGGATTTCGATCGTGCCCTCC
AGGCAGATGCCGATCTGTACAGCAAGGTTATCCAGCTGGGACGCCGTCCG
GACCAGCACCTCAAGCAGACTCTCAGCTTTGGCAGCTTCGTTCCCATCTT
CGGCGACGAGCAGAATCCGGACTTTATGATGTACAAAAACAACGAGGATC
AGGAACTTTACGGCGGGGGAAATCGCTACGATCGCCAATTCCTCAAGTAC
AACATCCTGTGA

RT04180.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
ETH.a 1535 ETH.a 217..828 1..612 3060 100 Plus
ETH-RA 1107 ETH-RA 252..863 1..612 3060 100 Plus
nc_9335.a 1392 nc_9335.a 414..834 607..187 2105 100 Minus
nc_9335.a 1392 nc_9335.a 893..1078 186..1 930 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20680730..20681154 611..187 2080 99.3 Minus
chr2R 21145070 chr2R 20681213..20681398 186..1 930 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24794789..24795214 612..187 2130 100 Minus
2R 25286936 2R 24795273..24795458 186..1 930 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24795988..24796413 612..187 2130 100 Minus
2R 25260384 2R 24796472..24796657 186..1 930 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:31:15 has no hits.

RT04180.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:32:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20680730..20681154 187..611 99 <- Minus
chr2R 20681213..20681398 1..186 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 16:03:56 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 1..611 1..611 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:27:23 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 1..611 1..611 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:00:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 1..612 1..612 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:21:35 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 1..612 1..612 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 16:03:54 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 1..611 1..611 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:27:23 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 1..611 1..611 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:00:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 25..635 1..611 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:21:35 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
ETH-RA 25..635 1..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:32:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24794790..24795214 187..611 100 <- Minus
2R 24795273..24795458 1..186 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:32:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24794790..24795214 187..611 100 <- Minus
2R 24795273..24795458 1..186 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:32:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24794790..24795214 187..611 100 <- Minus
2R 24795273..24795458 1..186 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:00:20 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20682796..20682981 1..186 100   Minus
arm_2R 20682313..20682737 187..611 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:40 Download gff for RT04180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24796007..24796431 187..611 100 <- Minus
2R 24796490..24796675 1..186 100   Minus

RT04180.pep Sequence

Translation from 0 to 611

> RT04180.pep
MRIITVLSVSLLVGLVAISQADDSSPGFFLKITKNVPRLGKRGENFAIKN
LKTIPRIGRSEHSSVTPLLAWLWDLETSPSKRRLPAGESPAKEQELNVVQ
PVNSNTLLELLDNNAIPSEQVKFVHWKDFDRALQADADLYSKVIQLGRRP
DQHLKQTLSFGSFVPIFGDEQNPDFMMYKNNEDQELYGGGNRYDRQFLKY
NIL*

RT04180.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11539-PA 204 GF11539-PA 19..202 19..201 705 75.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19887-PA 203 GG19887-PA 1..203 1..203 1027 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21534-PA 214 GH21534-PA 6..214 4..203 623 64 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
ETH-PA 203 CG18105-PA 1..203 1..203 1049 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19506-PA 205 GI19506-PA 1..205 1..203 660 64.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17694-PA 206 GL17694-PA 17..206 17..203 739 74.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14795-PA 206 GA14795-PA 17..206 17..203 731 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11787-PA 203 GM11787-PA 1..203 1..203 1047 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24915-PA 203 GD24915-PA 1..203 1..203 1038 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21076-PA 212 GJ21076-PA 6..212 4..203 644 64.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21645-PA 205 GK21645-PA 1..205 1..203 668 65.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11411-PA 203 GE11411-PA 1..203 1..203 1015 93.6 Plus

RT04180.hyp Sequence

Translation from 1 to 609

> RT04180.hyp
MRIITVLSVSLLVGLVAISQADDSSPGFFLKITKNVPRLGKRGENFAIKN
LKTIPRIGRSEHSSVTPLLAWLWDLETSPSKRRLPAGESPAKEQELNVVQ
PVNSNTLLELLDNNAIPSEQVKFVHWKDFDRALQADADLYSKVIQLGRRP
DQHLKQTLSFGSFVPIFGDEQNPDFMMYKNNEDQELYGGGNRYDRQFLKY
NIL

RT04180.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
ETH-PA 203 CG18105-PA 1..203 1..203 1049 100 Plus