Clone RT04435 Report

Search the DGRC for RT04435

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:44
Well:35
Vector:pCR2.1
Associated Gene/TranscriptTwdlV-RA
Protein status:RT04435.pep: gold
Sequenced Size:756

Clone Sequence Records

RT04435.complete Sequence

756 bp assembled on 2009-12-10

GenBank Submission: BT120015.1

> RT04435.complete
ATGAGTGGATTCATTGTCCTATGCCTTTGCTCCGTGGCTCTAGCCGCACC
CCAGGGCTACAACTATAACCCTGGCCCGTCCGGCTTCGGTGGCATCAGCA
CCACCACCGGTGGAGGCTCCTTCTTCCAAGGCGCCGTCCAGGTCGCCCCC
GTGCAACCGCAGGCCGTCTACCAACAGCCTGCCGCACAGACTCACCACCA
CCAGCAGCAGCAGGTGCAGCAGCAGCAGGCCATCGTCTCCAAGCGCTTCT
TCATCCACTCCGCCCCGGAGGAGGCTGAGGATTACAAGGAACGTCACATC
ACCGTCGGCGTGCCCAAGCGCAACTACAACGTGGTGTTCATCAAGTCGCC
GCAGCGCAACAACAGGAAGACCATCAAGATCAGCCCCGCCGCCAACGAGG
AGAAGACCGTCATCTACGTGCTGAGCAAGAAGGGCGAAAGCGACTTGAAC
GCCGAGGTAGTGGAGCAGGCCAGCTCCACCAGCAAGCCGGAGGTCTTCTT
CATCAAGTACAAGACCAACGAAGAGGCCGCCCACGCCCAGCAGCAGATCC
AAGCCCAGTACGACGCTCTGGGCGGCAGTAGCCAGTTGACCGATGAGGGA
GTGGCCCCAGTCACATCCGTGATTGGAGCGCTGGGTGGCAGTGACGGTCA
CATCGACGGCGGATCCGTTGTGGGCGCCACAGGAGCTGGTCAGATCGTCT
CCACCGGCACTGCCGGATCGCACACGGGCAATGCATACCTGCCACCCAAT
TTCTAA

RT04435.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlV-RA 1164 TwdlV-RA 138..893 1..756 3780 100 Plus
TwdlY-RA 1030 TwdlY-RA 607..705 479..577 270 84.8 Plus
Twdlalpha-RA 1370 Twdlalpha-RA 846..931 479..564 250 86 Plus
TwdlY-RA 1030 TwdlY-RA 522..558 397..433 155 94.5 Plus
Twdlalpha-RA 1370 Twdlalpha-RA 756..797 392..433 150 90.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 80575..81313 16..754 3695 100 Plus
chrX 22417052 chrX 16625220..16625318 479..577 270 84.8 Plus
chr3R 27901430 chr3R 73529..73611 484..566 250 86.7 Plus
chrX 22417052 chrX 16633436..16633502 479..545 245 91 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4254854..4255594 16..756 3705 100 Plus
X 23542271 X 16735557..16735655 479..577 270 84.8 Plus
3R 32079331 3R 4247807..4247889 484..566 250 86.7 Plus
X 23542271 X 16743774..16743840 479..545 230 89.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 3995685..3996425 16..756 3705 100 Plus
X 23527363 X 16743655..16743753 479..577 270 84.8 Plus
3R 31820162 3R 3988638..3988720 484..566 250 86.7 Plus
X 23527363 X 16751872..16751938 479..545 230 89.5 Plus
X 23527363 X 16746645..16746688 484..527 160 90.9 Plus
X 23527363 X 16743570..16743606 397..433 155 94.5 Plus
X 23527363 X 16751782..16751823 392..433 150 90.4 Plus
Blast to na_te.dros performed on 2019-03-15 12:56:01 has no hits.

RT04435.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:56:49 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 80575..81315 16..756 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-10 16:37:55 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:36 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 1..756 1..756 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:53:36 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 1..756 1..756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:16:16 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 1..756 1..756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-10 16:37:55 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:36 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 1..756 1..756 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:53:36 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 73..828 1..756 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:16:16 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlV-RA 73..828 1..756 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:49 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4254854..4255594 16..756 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:49 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4254854..4255594 16..756 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:56:49 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4254854..4255594 16..756 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:53:36 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 80576..81316 16..756 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:43 Download gff for RT04435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3995685..3996425 16..756 100   Plus

RT04435.pep Sequence

Translation from 0 to 755

> RT04435.pep
MSGFIVLCLCSVALAAPQGYNYNPGPSGFGGISTTTGGGSFFQGAVQVAP
VQPQAVYQQPAAQTHHHQQQQVQQQQAIVSKRFFIHSAPEEAEDYKERHI
TVGVPKRNYNVVFIKSPQRNNRKTIKISPAANEEKTVIYVLSKKGESDLN
AEVVEQASSTSKPEVFFIKYKTNEEAAHAQQQIQAQYDALGGSSQLTDEG
VAPVTSVIGALGGSDGHIDGGSVVGATGAGQIVSTGTAGSHTGNAYLPPN
F*

RT04435.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18197-PA 263 GF18197-PA 1..263 1..251 971 83.7 Plus
Dana\GF22658-PA 345 GF22658-PA 1..295 1..236 397 40.3 Plus
Dana\GF17860-PA 309 GF17860-PA 82..259 33..211 360 45.7 Plus
Dana\GF22662-PA 385 GF22662-PA 105..322 21..233 355 45.3 Plus
Dana\GF19934-PA 278 GF19934-PA 69..209 77..209 348 53.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12230-PA 252 GG12230-PA 1..252 1..251 1012 93.3 Plus
Dere\GG19072-PA 322 GG19072-PA 98..316 59..248 392 45.2 Plus
Dere\GG11741-PA 269 GG11741-PA 1..267 1..251 391 41.8 Plus
Dere\GG16788-PA 301 GG16788-PA 114..299 75..250 371 44.4 Plus
Dere\GG19073-PA 247 GG19073-PA 7..242 5..248 345 41 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19057-PA 287 GH19057-PA 1..287 1..251 625 65.1 Plus
Dgri\GH21845-PA 288 GH21845-PA 1..286 1..251 419 41.2 Plus
Dgri\GH11915-PA 620 GH11915-PA 392..571 75..246 389 50.8 Plus
Dgri\GH14248-PA 305 GH14248-PA 124..303 75..250 367 44.1 Plus
Dgri\GH11916-PA 242 GH11916-PA 74..218 78..222 343 52.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlV-PA 251 CG14640-PA 1..251 1..251 1294 100 Plus
TwdlX-PA 346 CG32571-PA 89..340 21..248 406 40.9 Plus
Twdlalpha-PA 388 CG32574-PA 109..337 19..246 395 43 Plus
TwdlG-PC 278 CG14643-PC 1..275 1..250 387 38.8 Plus
TwdlG-PB 278 CG14643-PB 1..275 1..250 387 38.8 Plus
TwdlG-PA 278 CG14643-PA 1..275 1..250 387 38.8 Plus
TwdlW-PA 308 CG4060-PA 89..306 51..250 376 42.5 Plus
TwdlF-PA 354 CG14639-PA 1..296 1..233 374 37.7 Plus
TwdlY-PA 247 CG32570-PA 7..215 5..213 365 44.3 Plus
TwdlQ-PA 245 CG14250-PA 1..205 1..204 305 39.2 Plus
TwdlZ-PB 210 CG32569-PB 32..173 76..211 300 44.4 Plus
TwdlD-PA 256 CG14243-PA 1..249 1..250 290 33.7 Plus
Tb-PA 283 CG5480-PA 1..218 1..204 259 33 Plus
TwdlH-PA 241 CG31080-PA 1..209 1..204 257 35.4 Plus
TwdlK-PA 247 CG6460-PA 1..212 1..202 240 33.3 Plus
TwdlJ-PB 274 CG5471-PB 6..215 5..202 237 34.1 Plus
TwdlB-PA 286 CG6478-PA 1..260 1..210 235 29.9 Plus
TwdlL-PA 285 CG6447-PA 1..260 1..210 233 29.5 Plus
TwdlL-PB 279 CG6447-PB 62..254 19..210 222 33 Plus
TwdlP-PA 220 CG14240-PA 1..184 1..202 220 32.7 Plus
TwdlM-PA 288 CG5468-PA 88..264 27..210 220 36.1 Plus
TwdlN-PA 309 CG5476-PA 108..273 25..202 213 36.1 Plus
TwdlO-PA 229 CG6452-PA 1..221 1..250 202 29 Plus
TwdlR-PA 325 CG31081-PA 52..194 63..202 190 37.5 Plus
TwdlT-PA 286 CG5812-PA 130..265 78..221 181 31.8 Plus
TwdlC-PA 360 CG14254-PA 85..311 43..249 174 27.5 Plus
Twdlbeta-PA 198 CG8986-PA 46..168 45..174 173 35.6 Plus
TwdlE-PA 197 CG14534-PA 38..160 50..175 159 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10848-PA 268 GI10848-PA 1..268 1..251 713 68.3 Plus
Dmoj\GI21932-PA 273 GI21932-PA 1..268 7..248 400 39 Plus
Dmoj\GI23141-PA 328 GI23141-PA 115..272 60..213 363 46.8 Plus
Dmoj\GI14656-PA 374 GI14656-PA 145..339 55..245 338 45.2 Plus
Dmoj\GI10847-PA 372 GI10847-PA 146..298 74..224 336 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12309-PA 437 GL12309-PA 186..437 5..251 857 78.7 Plus
Dper\GL12334-PA 296 GL12334-PA 130..293 78..241 357 49.1 Plus
Dper\GL27212-PA 312 GL27212-PA 126..263 78..211 357 52.2 Plus
Dper\GL26861-PA 223 GL26861-PA 33..173 76..211 306 45.1 Plus
Dper\GL24435-PA 251 GL24435-PA 1..221 1..213 291 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13139-PA 256 GA13139-PA 1..256 1..251 875 78.7 Plus
Dpse\GA16998-PA 344 GA16998-PA 118..300 59..236 394 48.9 Plus
Dpse\GA17925-PA 314 GA17925-PA 127..264 78..211 358 51.4 Plus
Dpse\GA13142-PA 296 GA13142-PA 130..293 78..241 355 48.5 Plus
Dpse\GA13137-PA 353 GA13137-PA 148..307 74..240 348 46.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10739-PA 254 GM10739-PA 1..254 1..251 1266 96.5 Plus
Dsec\GM15381-PA 306 GM15381-PA 123..304 75..250 384 46.4 Plus
Dsec\GM13462-PA 346 GM13462-PA 143..340 75..248 382 47 Plus
Dsec\GM10719-PA 281 GM10719-PA 1..279 1..251 351 39.2 Plus
Dsec\GM10738-PA 357 GM10738-PA 137..287 74..222 349 49.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19711-PA 255 GD19711-PA 1..255 1..251 1262 95.7 Plus
Dsim\GD17302-PA 346 GD17302-PA 143..340 75..248 384 47.5 Plus
Dsim\GD19694-PA 278 GD19694-PA 1..276 1..251 349 37.4 Plus
Dsim\GD19709-PA 357 GD19709-PA 137..287 74..222 349 49.7 Plus
Dsim\GD20247-PA 303 GD20247-PA 125..301 75..250 341 44.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14455-PA 269 GJ14455-PA 1..269 1..251 717 67.3 Plus
Dvir\GJ14291-PA 281 GJ14291-PA 1..269 1..229 402 41.1 Plus
Dvir\GJ19305-PA 387 GJ19305-PA 162..325 75..240 399 52.7 Plus
Dvir\GJ10443-PA 300 GJ10443-PA 106..263 60..213 360 46.8 Plus
Dvir\GJ19308-PA 368 GJ19308-PA 116..333 19..228 353 45.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22519-PA 265 GK22519-PA 1..265 1..251 867 77.2 Plus
Dwil\GK25414-PA 339 GK25414-PA 129..297 75..245 375 50.6 Plus
Dwil\GK10882-PA 315 GK10882-PA 109..313 47..250 365 39.7 Plus
Dwil\GK22650-PA 292 GK22650-PA 1..290 1..251 351 39.7 Plus
Dwil\GK22518-PA 337 GK22518-PA 138..278 77..209 338 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25400-PA 250 GE25400-PA 1..250 1..251 943 93.2 Plus
Dyak\GE17617-PA 351 GE17617-PA 148..345 75..248 391 48 Plus
Dyak\GE24178-PA 269 GE24178-PA 81..267 75..250 371 44.2 Plus
Dyak\GE25368-PA 265 GE25368-PA 1..244 1..221 366 42.3 Plus
Dyak\GE17621-PA 429 GE17621-PA 177..363 55..245 348 47.4 Plus

RT04435.hyp Sequence

Translation from 1 to 753

> RT04435.hyp
MSGFIVLCLCSVALAAPQGYNYNPGPSGFGGISTTTGGGSFFQGAVQVAP
VQPQAVYQQPAAQTHHHQQQQVQQQQAIVSKRFFIHSAPEEAEDYKERHI
TVGVPKRNYNVVFIKSPQRNNRKTIKISPAANEEKTVIYVLSKKGESDLN
AEVVEQASSTSKPEVFFIKYKTNEEAAHAQQQIQAQYDALGGSSQLTDEG
VAPVTSVIGALGGSDGHIDGGSVVGATGAGQIVSTGTAGSHTGNAYLPPN
F

RT04435.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlV-PA 251 CG14640-PA 1..251 1..251 1294 100 Plus
TwdlX-PA 346 CG32571-PA 89..340 21..248 406 40.9 Plus
Twdlalpha-PA 388 CG32574-PA 109..337 19..246 395 43 Plus
TwdlG-PC 278 CG14643-PC 1..275 1..250 387 38.8 Plus
TwdlG-PB 278 CG14643-PB 1..275 1..250 387 38.8 Plus