Clone RT05689 Report

Search the DGRC for RT05689

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:56
Well:89
Vector:pCR2.1
Associated Gene/TranscriptTfIIA-S-2-RA
Protein status:RT05689.pep: full length peptide match
Sequenced Size:324

Clone Sequence Records

RT05689.complete Sequence

324 bp assembled on 2010-01-29

GenBank Submission: BT120287.1

> RT05689.complete
ATGAACTATCAACATTACAGGGCCACAACGCTGGGCAGAACGCTCCAGGA
CACTTTGGATGAGATGATGGAGAGGGGCGATATAACCAAGAAGATTGCTA
ATTTGGTTTTACTAAGATATGACAAGAGCATTTCAACAGCTCTCAAGGAT
CATGGCACGAGCAATATGTCCTTTACGGCCGAAAGACTGGAAACCTTTAG
ATGCTGCGACAATGTGTGGACTCTGATCCTAAAGGACGCGGAGTTCCGCG
AGGATCAGCATTCCTTGAAGGTCGATGTGGTCAAAATTGTGGCCTGTCTT
GGAACTGACAATGGAAATGAATAA

RT05689.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-2-RA 546 TfIIA-S-2-RA 117..440 1..324 1620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 905113..905371 322..64 1265 99.2 Minus
chrX 22417052 chrX 905444..905515 72..1 360 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1011141..1011401 324..64 1275 99.2 Minus
X 23542271 X 1011474..1011545 72..1 360 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1019239..1019499 324..64 1275 99.2 Minus
X 23527363 X 1019572..1019643 72..1 360 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:59:46 has no hits.

RT05689.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:00:52 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 905111..905362 73..324 100 <- Minus
chrX 905444..905515 1..72 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-29 14:45:06 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 1..322 1..322 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:25 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 1..324 1..324 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:04:34 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 1..324 1..324 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:41 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 1..324 1..324 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-29 14:45:05 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 99..420 1..322 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:25 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 99..422 1..324 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:04:34 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 99..422 1..324 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:41 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-2-RA 99..422 1..324 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:00:52 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
X 1011141..1011392 73..324 100 <- Minus
X 1011474..1011545 1..72 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:00:52 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
X 1011141..1011392 73..324 100 <- Minus
X 1011474..1011545 1..72 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:00:52 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
X 1011141..1011392 73..324 100 <- Minus
X 1011474..1011545 1..72 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:04:34 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 905174..905425 73..324 100 <- Minus
arm_X 905507..905578 1..72 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:55 Download gff for RT05689.complete
Subject Subject Range Query Range Percent Splice Strand
X 1019239..1019490 73..324 100 <- Minus
X 1019572..1019643 1..72 100   Minus

RT05689.pep Sequence

Translation from 0 to 323

> RT05689.pep
MNYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKD
HGTSNMSFTAERLETFRCCDNVWTLILKDAEFREDQHSLKVDVVKIVACL
GTDNGNE*

RT05689.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18732-PA 106 GF18732-PA 1..101 1..101 286 55.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12724-PA 104 GG12724-PA 1..101 1..101 363 65.3 Plus
Dere\GG12397-PA 106 GG12397-PA 1..101 1..101 285 55.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10565-PA 107 GH10565-PA 1..101 1..101 286 55.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-2-PA 107 CG11639-PA 1..107 1..107 558 100 Plus
TfIIA-S-PA 106 CG5163-PA 1..101 1..101 278 55.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23054-PA 107 GI23054-PA 1..101 1..101 286 55.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24263-PA 105 GL24263-PA 1..101 1..101 285 55.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18701-PA 105 GA18701-PA 1..101 1..101 285 55.4 Plus
Dpse\GA26545-PA 129 GA26545-PA 1..108 1..107 254 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19003-PA 107 GM19003-PA 1..107 1..107 481 82.2 Plus
Dsec\GM23533-PA 106 GM23533-PA 1..101 1..101 285 55.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24638-PA 107 GD24638-PA 1..107 1..107 489 83.2 Plus
Dsim\GD18345-PA 106 GD18345-PA 1..101 1..101 285 55.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24638-PA 107 GJ24638-PA 1..101 1..101 286 55.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11978-PA 106 GK11978-PA 1..101 1..101 286 55.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16551-PA 104 GE16551-PA 1..101 1..101 363 64.4 Plus
Dyak\GE23914-PA 106 GE23914-PA 1..101 1..101 285 55.4 Plus

RT05689.hyp Sequence

Translation from 1 to 321

> RT05689.hyp
MNYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKD
HGTSNMSFTAERLETFRCCDNVWTLILKDAEFREDQHSLKVDVVKIVACL
GTDNGNE

RT05689.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-2-PA 107 CG11639-PA 1..107 1..107 558 100 Plus
TfIIA-S-PA 106 CG5163-PA 1..101 1..101 278 55.4 Plus