Clone RT05903 Report

Search the DGRC for RT05903

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:59
Well:3
Vector:pCR2.1
Associated Gene/Transcriptmei-W68-RA
Protein status:RT05903.pep: gold
Sequenced Size:996

Clone Sequence Records

RT05903.complete Sequence

996 bp assembled on 2010-02-26

GenBank Submission: BT120379.1

> RT05903.complete
ATGGATGAATTTTCGGAGAATATAGAAAGAATTGCCCTCGAGTTGCTGAG
CAACTTGGTTCATGGCAATGCCACTCTTAGTGTTCCCCGAAATTCATCCG
GAAACGTGATCTCGGAATATCGACGAGTCAGCTATAATAATCGCGGAAGT
CGCCATAGCTTTTGCGTGCTGATTTACATGCTCTCCCGGGTGCACCGATT
GCAAGTCCGCGGAGGAAGTTTCACCGTCCGTGGACTATACTATGACAATC
CTCTGCTAGTCCGGTCGCAGTCCAGGATTGCCGAAGCCAGGCTAGATGTC
TGTCGTATGCTGAGGACATCCCCCCTAAGCTTGGGCATACTGGCCGCCTC
CAAGGGCCTGGTGGCAGGCGACTTAAGGCTGCTGATGACCAACGGAGACG
TTCTGGACAGCAGCTTGTATGGTGGACCTCTGACATTGCCCACGGATCCC
GAGAAGATAGATCGAATCGAAACGCTGGCGGAATTTGTGCTAATCGTTGA
AAAGGAGTCGGTTTTTGAGAGTCTCTTATCCAGAAATGTATTTGGTACTT
TTGAACGACGCTTCATCCTTATAACTGGAAAAGGATACCCCGATTGCTGT
ACCCGGAGGATTGTCCATCGGCTCACCGAGGAGAACCAACTGGCGGCCTA
CATTCTCGTTGACGCCGATCCATTTGGCGTCGAGATAATGCTAGTCTATC
GCCATGGCTCGAAGTCCATGAGTTTTTCCAGCCAAGGACTAACCACACCT
GCGCTGCGTTGGATTGGTCTACACCCCTCGGAGATTCCCGCACTCGGCAC
TGGAGCGGTTGCCCTGGTTGCCGGCGACAACAAGAAAATCAATGACCTCC
TCGCCCGCCACGATTTGGAGCCGGGAGTGCGGCAGGAACTGCGCATGCTG
CAGGACGTTCAGCTGAAGGCCGAAATCGAGAGTGTCATCGACTTCCTGAC
CGACGACTATATACCAAATAAAATCAATCGGAACTTGTTTTTGTAG

RT05903.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
mei-W68-RA 2276 mei-W68-RA 862..1857 1..996 4980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15345634..15346266 364..996 3165 100 Plus
chr2R 21145070 chr2R 15345213..15345580 1..368 1840 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19458473..19459105 364..996 3165 100 Plus
2R 25286936 2R 19458052..19458419 1..368 1840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19459672..19460304 364..996 3165 100 Plus
2R 25260384 2R 19459251..19459618 1..368 1840 100 Plus
Blast to na_te.dros performed 2019-03-15 16:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 2991..3074 192..276 125 64 Plus

RT05903.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:01:46 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15345213..15345579 1..367 100 -> Plus
chr2R 15345638..15346266 368..996 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 13:28:15 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:47 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:48:54 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:25 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 13:28:14 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 862..1857 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:47 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 862..1857 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:48:54 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 887..1882 1..996 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:25 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
mei-W68-RA 887..1882 1..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:46 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19458052..19458418 1..367 100 -> Plus
2R 19458477..19459105 368..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:46 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19458052..19458418 1..367 100 -> Plus
2R 19458477..19459105 368..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:46 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19458052..19458418 1..367 100 -> Plus
2R 19458477..19459105 368..996 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:48:54 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15345557..15345923 1..367 100 -> Plus
arm_2R 15345982..15346610 368..996 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:15 Download gff for RT05903.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19459251..19459617 1..367 100 -> Plus
2R 19459676..19460304 368..996 100   Plus

RT05903.pep Sequence

Translation from 0 to 995

> RT05903.pep
MDEFSENIERIALELLSNLVHGNATLSVPRNSSGNVISEYRRVSYNNRGS
RHSFCVLIYMLSRVHRLQVRGGSFTVRGLYYDNPLLVRSQSRIAEARLDV
CRMLRTSPLSLGILAASKGLVAGDLRLLMTNGDVLDSSLYGGPLTLPTDP
EKIDRIETLAEFVLIVEKESVFESLLSRNVFGTFERRFILITGKGYPDCC
TRRIVHRLTEENQLAAYILVDADPFGVEIMLVYRHGSKSMSFSSQGLTTP
ALRWIGLHPSEIPALGTGAVALVAGDNKKINDLLARHDLEPGVRQELRML
QDVQLKAEIESVIDFLTDDYIPNKINRNLFL*

RT05903.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11715-PA 330 GF11715-PA 1..330 1..331 1289 72.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21975-PA 331 GG21975-PA 1..331 1..331 1638 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20206-PA 334 GH20206-PA 11..334 7..331 1076 62.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
mei-W68-PA 331 CG7753-PA 1..331 1..331 1674 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20732-PA 325 GI20732-PA 12..325 8..331 1019 59.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10528-PA 333 GL10528-PA 1..333 4..331 1212 68.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24396-PA 333 GA24396-PA 1..333 4..331 1203 68.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13291-PA 331 GM13291-PA 1..331 1..331 1690 97.3 Plus
Dsec\GM21963-PA 331 GM21963-PA 1..331 1..331 1690 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11457-PA 331 GD11457-PA 1..331 1..331 1689 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20469-PA 349 GJ20469-PA 1..349 1..331 1050 59.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15872-PA 346 GK15872-PA 15..346 7..331 1096 63.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12053-PA 331 GE12053-PA 1..331 1..331 1635 93.4 Plus

RT05903.hyp Sequence

Translation from 1 to 995

> RT05903.hyp
MDEFSENIERIALELLSNLVHGNATLSVPRNSSGNVISEYRRVSYNNRGS
RHSFCVLIYMLSRVHRLQVRGGSFTVRGLYYDNPLLVRSQSRIAEARLDV
CRMLRTSPLSLGILAASKGLVAGDLRLLMTNGDVLDSSLYGGPLTLPTDP
EKIDRIETLAEFVLIVEKESVFESLLSRNVFGTFERRFILITGKGYPDCC
TRRIVHRLTEENQLAAYILVDADPFGVEIMLVYRHGSKSMSFSSQGLTTP
ALRWIGLHPSEIPALGTGAVALVAGDNKKINDLLARHDLEPGVRQELRML
QDVQLKAEIESVIDFLTDDYIPNKINRNLFL*

RT05903.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
mei-W68-PA 331 CG7753-PA 1..331 1..331 1674 100 Plus