RT05923.complete Sequence
444 bp assembled on 2011-07-27
GenBank Submission: BT120386.2
> RT05923.complete
ATGTATTTTGCCATCCGACTAAGCTTTGTTCTGGCAGTGCTCATCTGTCT
CACAGGAAACGGAAGTGCTAGAATGCTGGATGCAGATCGCAACCGGCTCC
AGCAACTTCAGATTCGAAGTCAGCAATCTGCGGATGCCAACACCCAGGTG
GATATTGCTTATGAAGTCATCGGAATTTATGATAAATACAAGGGCCAGGG
GGGATCGAATGTGTTGAGAGAGGCTCAATTGAATTCACAAGTTAATGACT
TTAAAAGAAAGACTATGGTCATCGATGGAGTGCCAGCCCAAGGAGGAGTT
TGGGGTATTTTAGGAGCAATAAAGAAGGCCGCTGATGCCGTTCCTGACAA
TGTGAAGAAAGATGCTGAGAACTTGGTTAAGAGCTCTACAAAAGTCTTAG
TTCGGGGCATATACGACTATCTTATGGGTAAAATGAAGCACTGA
RT05923.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:35:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotZ-RA | 743 | TotZ-RA | 121..563 | 1..443 | 2200 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 16701721..16702142 | 22..443 | 2095 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 20877842..20878264 | 22..444 | 2100 | 99.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 20618673..20619095 | 22..444 | 2100 | 99.7 | Plus |
Blast to na_te.dros performed on 2019-03-15 10:50:50 has no hits.
RT05923.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:46 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 16701645..16701667 | 1..23 | 100 | -> | Plus |
chr3R | 16701723..16702142 | 24..443 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 15:38:39 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 1..443 | 1..443 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:31 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 1..444 | 1..444 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:41 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 1..444 | 1..444 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:27 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 1..444 | 1..444 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 15:38:38 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 31..473 | 1..443 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:31 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 31..473 | 1..443 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:41 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 31..473 | 1..443 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:27 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotZ-RA | 31..473 | 1..443 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:46 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20877766..20877788 | 1..23 | 100 | -> | Plus |
3R | 20877844..20878263 | 24..443 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:46 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20877766..20877788 | 1..23 | 100 | -> | Plus |
3R | 20877844..20878263 | 24..443 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:46 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20877766..20877788 | 1..23 | 100 | -> | Plus |
3R | 20877844..20878263 | 24..443 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:41 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 16703488..16703510 | 1..23 | 100 | -> | Plus |
arm_3R | 16703566..16703985 | 24..443 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:57 Download gff for
RT05923.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20618675..20619094 | 24..443 | 99 | | Plus |
3R | 20618597..20618619 | 1..23 | 100 | -> | Plus |
RT05923.pep Sequence
Translation from 0 to 443
> RT05923.pep
MYFAIRLSFVLAVLICLTGNGSARMLDADRNRLQQLQIRSQQSADANTQV
DIAYEVIGIYDKYKGQGGSNVLREAQLNSQVNDFKRKTMVIDGVPAQGGV
WGILGAIKKAADAVPDNVKKDAENLVKSSTKVLVRGIYDYLMGKMKH*
RT05923.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotZ-PA | 147 | CG31507-PA | 1..147 | 1..147 | 740 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:14:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL23250-PA | 151 | GL23250-PA | 1..141 | 1..145 | 250 | 40.3 | Plus |
Dper\GL15782-PA | 142 | GL15782-PA | 1..137 | 1..141 | 229 | 38.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:14:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16287-PA | 151 | GA16287-PA | 1..141 | 1..145 | 251 | 40.3 | Plus |
Dpse\GA23180-PA | 142 | GA23180-PA | 1..137 | 1..141 | 219 | 37.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:14:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23146-PA | 148 | GM23146-PA | 1..147 | 1..147 | 749 | 98 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:14:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19385-PA | 148 | GD19385-PA | 1..147 | 1..147 | 752 | 98.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:14:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25696-PA | 141 | GE25696-PA | 1..140 | 1..142 | 510 | 70.4 | Plus |
RT05923.hyp Sequence
Translation from 1 to 441
> RT05923.hyp
MYFAIRLSFVLAVLICLTGNGSARMLDADRNRLQQLQIRSQQSADANTQV
DIAYEVIGIYDKYKGQGGSNVLREAQLNSQVNDFKRKTMVIDGVPAQGGV
WGILGAIKKAADAVPDNVKKDAENLVKSSTKVLVRGIYDYLMGKMKH
RT05923.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotZ-PA | 147 | CG31507-PA | 1..147 | 1..147 | 740 | 100 | Plus |