Clone RT05923 Report

Search the DGRC for RT05923

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:59
Well:23
Vector:pCR2.1
Associated Gene/TranscriptTotZ-RA
Protein status:RT05923.pep: gold
Sequenced Size:444

Clone Sequence Records

RT05923.complete Sequence

444 bp assembled on 2011-07-27

GenBank Submission: BT120386.2

> RT05923.complete
ATGTATTTTGCCATCCGACTAAGCTTTGTTCTGGCAGTGCTCATCTGTCT
CACAGGAAACGGAAGTGCTAGAATGCTGGATGCAGATCGCAACCGGCTCC
AGCAACTTCAGATTCGAAGTCAGCAATCTGCGGATGCCAACACCCAGGTG
GATATTGCTTATGAAGTCATCGGAATTTATGATAAATACAAGGGCCAGGG
GGGATCGAATGTGTTGAGAGAGGCTCAATTGAATTCACAAGTTAATGACT
TTAAAAGAAAGACTATGGTCATCGATGGAGTGCCAGCCCAAGGAGGAGTT
TGGGGTATTTTAGGAGCAATAAAGAAGGCCGCTGATGCCGTTCCTGACAA
TGTGAAGAAAGATGCTGAGAACTTGGTTAAGAGCTCTACAAAAGTCTTAG
TTCGGGGCATATACGACTATCTTATGGGTAAAATGAAGCACTGA

RT05923.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
TotZ-RA 743 TotZ-RA 121..563 1..443 2200 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16701721..16702142 22..443 2095 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20877842..20878264 22..444 2100 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20618673..20619095 22..444 2100 99.7 Plus
Blast to na_te.dros performed on 2019-03-15 10:50:50 has no hits.

RT05923.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:46 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16701645..16701667 1..23 100 -> Plus
chr3R 16701723..16702142 24..443 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 15:38:39 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 1..443 1..443 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:31 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 1..444 1..444 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:41 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 1..444 1..444 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:27 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 1..444 1..444 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 15:38:38 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 31..473 1..443 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:31 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 31..473 1..443 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:41 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 31..473 1..443 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:27 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
TotZ-RA 31..473 1..443 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:46 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20877766..20877788 1..23 100 -> Plus
3R 20877844..20878263 24..443 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:46 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20877766..20877788 1..23 100 -> Plus
3R 20877844..20878263 24..443 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:46 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20877766..20877788 1..23 100 -> Plus
3R 20877844..20878263 24..443 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:41 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16703488..16703510 1..23 100 -> Plus
arm_3R 16703566..16703985 24..443 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:57 Download gff for RT05923.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20618675..20619094 24..443 99   Plus
3R 20618597..20618619 1..23 100 -> Plus

RT05923.pep Sequence

Translation from 0 to 443

> RT05923.pep
MYFAIRLSFVLAVLICLTGNGSARMLDADRNRLQQLQIRSQQSADANTQV
DIAYEVIGIYDKYKGQGGSNVLREAQLNSQVNDFKRKTMVIDGVPAQGGV
WGILGAIKKAADAVPDNVKKDAENLVKSSTKVLVRGIYDYLMGKMKH*

RT05923.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
TotZ-PA 147 CG31507-PA 1..147 1..147 740 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23250-PA 151 GL23250-PA 1..141 1..145 250 40.3 Plus
Dper\GL15782-PA 142 GL15782-PA 1..137 1..141 229 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16287-PA 151 GA16287-PA 1..141 1..145 251 40.3 Plus
Dpse\GA23180-PA 142 GA23180-PA 1..137 1..141 219 37.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23146-PA 148 GM23146-PA 1..147 1..147 749 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19385-PA 148 GD19385-PA 1..147 1..147 752 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25696-PA 141 GE25696-PA 1..140 1..142 510 70.4 Plus

RT05923.hyp Sequence

Translation from 1 to 441

> RT05923.hyp
MYFAIRLSFVLAVLICLTGNGSARMLDADRNRLQQLQIRSQQSADANTQV
DIAYEVIGIYDKYKGQGGSNVLREAQLNSQVNDFKRKTMVIDGVPAQGGV
WGILGAIKKAADAVPDNVKKDAENLVKSSTKVLVRGIYDYLMGKMKH

RT05923.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
TotZ-PA 147 CG31507-PA 1..147 1..147 740 100 Plus