Clone RT06416 Report

Search the DGRC for RT06416

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:64
Well:16
Vector:pCR2.1
Associated Gene/TranscriptObp46a-RA
Protein status:RT06416.pep: full length peptide match
Sequenced Size:597

Clone Sequence Records

RT06416.complete Sequence

597 bp assembled on 2010-03-03

GenBank Submission: BT122055.1

> RT06416.complete
ATGTGCTCCCAACTGTTCGCATTTCTGCTCCTCCTTTTGACCGCTTTTGT
GACGGGTAGAAGTACTCCACCGGCGTTGGATGAAGACTGTGAACTGAATT
CTGTAGATACAATGCATGATTTCTGCTGCGACCTGCACGACGAGAGTCCC
CAGTTTAGCGACTGCCAGATGGAGTGGCACGAAAAGATTCCATACGAGAC
GGATGAAGAGGAGCAGACGTACATGTTTTGCACCGCAGAGTGCAGTTTCA
ACAGTACGAACTTCTTGGGCAGGGACCGCCGTTCACTGAATCTCAATGAG
GTAAAGGAGCACTTGGAAAGCGACCTGGTCAACGATGCGGACATTAAGCT
TCTCTATGACACCTATGTCAAGTGCGACAAGCATGCGCTCTCACTGATGC
CGCACAAAGGTGTGAAGCAGCTATCCAAACGTCTTTCGCGTCTTGGCTGT
CATCCGTATCCCGGACTGGTCCTCGAGTGCGTGGCCAACGAGATGATCCT
GCACTGTCCCACCAAGCGCTTCCGTCAAACAGCCCAGTGCGAAGAGACAC
GCAATCATTTGAAGCAATGTATGCAGTATCTAAAGTACAAGTCCTAG

RT06416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Obp46a.a 1363 Obp46a.a 767..1363 1..597 2985 100 Plus
Obp46a-RA 744 Obp46a-RA 148..744 1..597 2985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6198689..6198901 597..385 1050 99.5 Minus
chr2R 21145070 chr2R 6198959..6199115 385..229 785 100 Minus
chr2R 21145070 chr2R 6199430..6199543 114..1 570 100 Minus
chr2R 21145070 chr2R 6199167..6199281 228..114 560 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10311172..10311384 597..385 1065 100 Minus
2R 25286936 2R 10311442..10311598 385..229 785 100 Minus
2R 25286936 2R 10311650..10311764 228..114 575 100 Minus
2R 25286936 2R 10311910..10312023 114..1 570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10312371..10312583 597..385 1065 100 Minus
2R 25260384 2R 10312641..10312797 385..229 785 100 Minus
2R 25260384 2R 10312849..10312963 228..114 575 100 Minus
2R 25260384 2R 10313109..10313222 114..1 570 100 Minus
Blast to na_te.dros performed 2019-03-15 18:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 3290..3332 240..198 107 72.1 Minus

RT06416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:15:06 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6198689..6198900 386..597 99 <- Minus
chr2R 6198959..6199115 229..385 100 <- Minus
chr2R 6199167..6199280 115..228 99 <- Minus
chr2R 6199430..6199543 1..114 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 17:26:24 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:56:00 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:57:45 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:57:04 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 17:26:18 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:56:00 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:57:45 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:57:04 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
Obp46a-RA 1..597 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:15:06 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10311172..10311383 386..597 100 <- Minus
2R 10311442..10311598 229..385 100 <- Minus
2R 10311650..10311763 115..228 100 <- Minus
2R 10311910..10312023 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:15:06 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10311172..10311383 386..597 100 <- Minus
2R 10311442..10311598 229..385 100 <- Minus
2R 10311650..10311763 115..228 100 <- Minus
2R 10311910..10312023 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:15:06 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10311172..10311383 386..597 100 <- Minus
2R 10311442..10311598 229..385 100 <- Minus
2R 10311650..10311763 115..228 100 <- Minus
2R 10311910..10312023 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:57:45 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6198947..6199103 229..385 100 <- Minus
arm_2R 6199155..6199268 115..228 100 <- Minus
arm_2R 6199415..6199528 1..114 100   Minus
arm_2R 6198677..6198888 386..597 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:33 Download gff for RT06416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10312371..10312582 386..597 100 <- Minus
2R 10312641..10312797 229..385 100 <- Minus
2R 10312849..10312962 115..228 100 <- Minus
2R 10313109..10313222 1..114 100   Minus

RT06416.pep Sequence

Translation from 0 to 596

> RT06416.pep
MCSQLFAFLLLLLTAFVTGRSTPPALDEDCELNSVDTMHDFCCDLHDESP
QFSDCQMEWHEKIPYETDEEEQTYMFCTAECSFNSTNFLGRDRRSLNLNE
VKEHLESDLVNDADIKLLYDTYVKCDKHALSLMPHKGVKQLSKRLSRLGC
HPYPGLVLECVANEMILHCPTKRFRQTAQCEETRNHLKQCMQYLKYKS*

RT06416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12128-PA 438 GF12128-PA 273..438 33..198 705 74.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25220-PA 198 GG25220-PA 1..198 1..198 935 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20112-PA 195 GH20112-PA 22..194 24..196 644 67.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Obp46a-PA 198 CG12905-PA 1..198 1..198 1083 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20206-PA 194 GI20206-PA 22..190 24..192 601 63.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11604-PA 197 GL11604-PA 11..197 9..195 706 69.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp46a-PA 200 GA11895-PA 10..200 7..198 713 67.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20539-PA 198 GM20539-PA 1..198 1..198 964 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp46a-PA 198 GD25996-PA 1..198 1..198 1026 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp46a-PA 192 GJ20154-PA 19..191 24..196 650 67.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18014-PA 196 GK18014-PA 7..196 10..196 666 63.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21655-PA 198 GE21655-PA 1..198 1..198 908 89.9 Plus

RT06416.hyp Sequence

Translation from 1 to 596

> RT06416.hyp
MCSQLFAFLLLLLTAFVTGRSTPPALDEDCELNSVDTMHDFCCDLHDESP
QFSDCQMEWHEKIPYETDEEEQTYMFCTAECSFNSTNFLGRDRRSLNLNE
VKEHLESDLVNDADIKLLYDTYVKCDKHALSLMPHKGVKQLSKRLSRLGC
HPYPGLVLECVANEMILHCPTKRFRQTAQCEETRNHLKQCMQYLKYKS*

RT06416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Obp46a-PA 198 CG12905-PA 1..198 1..198 1083 100 Plus