Clone RT06526 Report

Search the DGRC for RT06526

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:65
Well:26
Vector:pCR2.1
Associated Gene/TranscriptBurs-RA
Protein status:RT06526.pep: full length peptide match
Sequenced Size:522

Clone Sequence Records

RT06526.complete Sequence

522 bp assembled on 2010-03-03

GenBank Submission: BT122042.1

> RT06526.complete
ATGCTGCGCCACCTGCTCCGCCACGAGAACAACAAGGTCTTCGTCCTGAT
CCTGCTCTACTGCGTCCTGGTCAGCATTCTGAAACTCTGCACGGCACAGC
CGGATAGCTCTGTGGCCGCCACGGATAATGATATTACGCATCTTGGCGAC
GATTGTCAGGTGACGCCCGTCATCCATGTGCTCCAGTATCCTGGATGTGT
GCCCAAGCCGATTCCCTCGTTCGCCTGCGTGGGTCGCTGTGCCAGTTATA
TCCAGGTTTCGGGCAGTAAGATCTGGCAAATGGAGCGTTCCTGCATGTGC
TGCCAGGAGTCTGGTGAGCGGGAGGCAGCCGTCTCGCTATTCTGTCCCAA
AGTGAAGCCCGGCGAGCGTAAATTCAAGAAGGTCCTGACCAAGGCGCCAT
TGGAGTGCATGTGTCGGCCATGCACTTCCATTGAGGAGTCTGGCATCATA
CCACAGGAAATTGCCGGCTATTCGGACGAGGGTCCACTCAACAATCACTT
CCGGCGCATTGCTCTGCAATAG

RT06526.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
burs-RA 820 burs-RA 196..717 1..522 2610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17593681..17593949 254..522 1345 100 Plus
chr3R 27901430 chr3R 17593306..17593440 1..135 660 99.3 Plus
chr3R 27901430 chr3R 17593499..17593626 130..257 625 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21769926..21770194 254..522 1345 100 Plus
3R 32079331 3R 21769551..21769685 1..135 660 99.3 Plus
3R 32079331 3R 21769744..21769871 130..257 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21510757..21511025 254..522 1345 100 Plus
3R 31820162 3R 21510382..21510516 1..135 660 99.2 Plus
3R 31820162 3R 21510575..21510702 130..257 640 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:33:02 has no hits.

RT06526.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:34:10 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17593306..17593435 1..130 100 -> Plus
chr3R 17593500..17593624 131..255 99 -> Plus
chr3R 17593683..17593949 256..522 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 12:33:54 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
burs-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:46 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
burs-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:01:15 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
burs-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:22:51 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
Burs-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 12:33:50 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
burs-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:46 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
burs-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:01:15 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
burs-RA 34..555 1..522 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:22:51 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
Burs-RA 34..555 1..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:34:10 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21769928..21770194 256..522 100   Plus
3R 21769745..21769869 131..255 100 -> Plus
3R 21769551..21769680 1..130 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:34:10 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21769928..21770194 256..522 100   Plus
3R 21769745..21769869 131..255 100 -> Plus
3R 21769551..21769680 1..130 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:34:10 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21769928..21770194 256..522 100   Plus
3R 21769745..21769869 131..255 100 -> Plus
3R 21769551..21769680 1..130 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:01:15 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17595650..17595916 256..522 100   Plus
arm_3R 17595273..17595402 1..130 100 -> Plus
arm_3R 17595467..17595591 131..255 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:19 Download gff for RT06526.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21510759..21511025 256..522 100   Plus
3R 21510382..21510511 1..130 100 -> Plus
3R 21510576..21510700 131..255 100 -> Plus

RT06526.pep Sequence

Translation from 0 to 521

> RT06526.pep
MLRHLLRHENNKVFVLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGD
DCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMC
CQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGII
PQEIAGYSDEGPLNNHFRRIALQ*

RT06526.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18044-PA 173 GF18044-PA 1..173 1..173 887 94.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11041-PA 173 GG11041-PA 1..173 1..173 904 97.1 Plus
Dere\GG17481-PA 173 GG17481-PA 1..173 1..173 904 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18623-PA 173 GH18623-PA 1..173 1..173 856 92.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Burs-PA 173 CG13419-PA 1..173 1..173 930 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24294-PA 172 GI24294-PA 1..172 1..173 847 92.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23793-PA 173 GL23793-PA 1..173 1..173 885 96.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12271-PA 173 GA12271-PA 1..173 1..173 885 96.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26374-PA 173 GM26374-PA 1..173 1..173 918 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20896-PA 173 GD20896-PA 1..173 1..173 918 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23072-PA 174 GJ23072-PA 1..174 1..173 808 90.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12896-PA 173 GK12896-PA 1..173 1..173 880 94.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10240-PA 173 GE10240-PA 1..173 1..173 908 98.3 Plus

RT06526.hyp Sequence

Translation from 1 to 521

> RT06526.hyp
MLRHLLRHENNKVFVLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGD
DCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMC
CQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGII
PQEIAGYSDEGPLNNHFRRIALQ*

RT06526.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Burs-PA 173 CG13419-PA 1..173 1..173 930 100 Plus