![]() | BDGP Sequence Production Resources |
Search the DGRC for RT06526
Library: | RT |
Tissue Source: | D melanogaster pooled RNA |
Created by: | |
Date Registered: | 2006-04-14 |
Comments: | TA cloning vector from Invitrogen |
Original Plate Number: | 65 |
Well: | 26 |
Vector: | pCR2.1 |
Associated Gene/Transcript | Burs-RA |
Protein status: | RT06526.pep: full length peptide match |
Sequenced Size: | 522 |
522 bp assembled on 2010-03-03
GenBank Submission: BT122042.1
> RT06526.complete ATGCTGCGCCACCTGCTCCGCCACGAGAACAACAAGGTCTTCGTCCTGAT CCTGCTCTACTGCGTCCTGGTCAGCATTCTGAAACTCTGCACGGCACAGC CGGATAGCTCTGTGGCCGCCACGGATAATGATATTACGCATCTTGGCGAC GATTGTCAGGTGACGCCCGTCATCCATGTGCTCCAGTATCCTGGATGTGT GCCCAAGCCGATTCCCTCGTTCGCCTGCGTGGGTCGCTGTGCCAGTTATA TCCAGGTTTCGGGCAGTAAGATCTGGCAAATGGAGCGTTCCTGCATGTGC TGCCAGGAGTCTGGTGAGCGGGAGGCAGCCGTCTCGCTATTCTGTCCCAA AGTGAAGCCCGGCGAGCGTAAATTCAAGAAGGTCCTGACCAAGGCGCCAT TGGAGTGCATGTGTCGGCCATGCACTTCCATTGAGGAGTCTGGCATCATA CCACAGGAAATTGCCGGCTATTCGGACGAGGGTCCACTCAACAATCACTT CCGGCGCATTGCTCTGCAATAG
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
burs-RA | 820 | burs-RA | 196..717 | 1..522 | 2610 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 17593681..17593949 | 254..522 | 1345 | 100 | Plus |
chr3R | 27901430 | chr3R | 17593306..17593440 | 1..135 | 660 | 99.3 | Plus |
chr3R | 27901430 | chr3R | 17593499..17593626 | 130..257 | 625 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 21769926..21770194 | 254..522 | 1345 | 100 | Plus |
3R | 32079331 | 3R | 21769551..21769685 | 1..135 | 660 | 99.3 | Plus |
3R | 32079331 | 3R | 21769744..21769871 | 130..257 | 640 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 21510757..21511025 | 254..522 | 1345 | 100 | Plus |
3R | 31820162 | 3R | 21510382..21510516 | 1..135 | 660 | 99.2 | Plus |
3R | 31820162 | 3R | 21510575..21510702 | 130..257 | 640 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 17593306..17593435 | 1..130 | 100 | -> | Plus |
chr3R | 17593500..17593624 | 131..255 | 99 | -> | Plus |
chr3R | 17593683..17593949 | 256..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
burs-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
burs-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
burs-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Burs-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
burs-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
burs-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
burs-RA | 34..555 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Burs-RA | 34..555 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21769928..21770194 | 256..522 | 100 | Plus | |
3R | 21769745..21769869 | 131..255 | 100 | -> | Plus |
3R | 21769551..21769680 | 1..130 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21769928..21770194 | 256..522 | 100 | Plus | |
3R | 21769745..21769869 | 131..255 | 100 | -> | Plus |
3R | 21769551..21769680 | 1..130 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21769928..21770194 | 256..522 | 100 | Plus | |
3R | 21769745..21769869 | 131..255 | 100 | -> | Plus |
3R | 21769551..21769680 | 1..130 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 17595650..17595916 | 256..522 | 100 | Plus | |
arm_3R | 17595273..17595402 | 1..130 | 100 | -> | Plus |
arm_3R | 17595467..17595591 | 131..255 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21510759..21511025 | 256..522 | 100 | Plus | |
3R | 21510382..21510511 | 1..130 | 100 | -> | Plus |
3R | 21510576..21510700 | 131..255 | 100 | -> | Plus |
Translation from 0 to 521
> RT06526.pep MLRHLLRHENNKVFVLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGD DCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMC CQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGII PQEIAGYSDEGPLNNHFRRIALQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18044-PA | 173 | GF18044-PA | 1..173 | 1..173 | 887 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11041-PA | 173 | GG11041-PA | 1..173 | 1..173 | 904 | 97.1 | Plus |
Dere\GG17481-PA | 173 | GG17481-PA | 1..173 | 1..173 | 904 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18623-PA | 173 | GH18623-PA | 1..173 | 1..173 | 856 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Burs-PA | 173 | CG13419-PA | 1..173 | 1..173 | 930 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24294-PA | 172 | GI24294-PA | 1..172 | 1..173 | 847 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23793-PA | 173 | GL23793-PA | 1..173 | 1..173 | 885 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12271-PA | 173 | GA12271-PA | 1..173 | 1..173 | 885 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26374-PA | 173 | GM26374-PA | 1..173 | 1..173 | 918 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20896-PA | 173 | GD20896-PA | 1..173 | 1..173 | 918 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23072-PA | 174 | GJ23072-PA | 1..174 | 1..173 | 808 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12896-PA | 173 | GK12896-PA | 1..173 | 1..173 | 880 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10240-PA | 173 | GE10240-PA | 1..173 | 1..173 | 908 | 98.3 | Plus |
Translation from 1 to 521
> RT06526.hyp MLRHLLRHENNKVFVLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGD DCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMC CQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGII PQEIAGYSDEGPLNNHFRRIALQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Burs-PA | 173 | CG13419-PA | 1..173 | 1..173 | 930 | 100 | Plus |