Clone RT06593 Report

Search the DGRC for RT06593

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:65
Well:93
Vector:pCR2.1
Associated Gene/TranscriptObp58c-RA
Protein status:RT06593.pep: full length peptide match
Sequenced Size:600

Clone Sequence Records

RT06593.complete Sequence

600 bp assembled on 2010-03-03

GenBank Submission: BT122043.1

> RT06593.complete
ATGAAGTGCACCATTTTATTGAGTTTTTTCAGCCTGATTTGGTTTGCTGG
TGGAATTAAAATTGATTGCGAGAATACGGAGGCCATTAACGAGGACCACA
TCCACTATTGCTGCAAGCATCCCGATGGACACAATGATCTAATCGAAGGA
TGTGCCAGGGAGACCAATTTTACGCTGCCCAATCAAAACGAGGAGGCACT
GGTGGACATCACGGCGGACCGAGCCATCCGAGGCACTTGTTTTGGCAAAT
GCGTCTTTAGCAAACTGAACCTGATGAAGGACAACAACCTGGACATGGAT
GCCGTGAGAAGTTTGTTCACTGAAAGGTTTCCCGACGATCCGGAATATGC
CAAGGAAATGATCAACGCCTTTGATCATTGTCACGGCAAAAGCGAAGAGA
ATACCTCCATGTTCCTGTCGAAGCCCCTCTTCAAGCAAATGTCCAAGCAA
TTCTGCGATCCGAAGTCTAGTGTCGTCCTGGCCTGTGTCATCCGCCAGTT
CTTCCACAACTGCCCGGCGGATCGCTGGTCGAAGACCAAGGAGTGCGAGG
ATACCCTGGCCTTCAGCAAGAAGTGCCAGGACTCGCTGGCTACTTTGTGA

RT06593.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Obp58c-RA 814 Obp58c-RA 142..741 1..600 3000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18592688..18593045 392..35 1700 98.3 Minus
chr2R 21145070 chr2R 18592421..18592632 599..388 1030 99.1 Minus
chr2R 21145070 chr2R 18593094..18593135 42..1 195 97.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22706213..22706570 392..35 1760 99.4 Minus
2R 25286936 2R 22705945..22706157 600..388 1050 99.5 Minus
2R 25286936 2R 22706619..22706660 42..1 210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22707412..22707769 392..35 1760 99.4 Minus
2R 25260384 2R 22707144..22707356 600..388 1050 99.5 Minus
2R 25260384 2R 22707818..22707859 42..1 210 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:04:15 has no hits.

RT06593.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:05:07 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18592421..18592628 392..599 99 <- Minus
chr2R 18592689..18593037 43..391 98 <- Minus
chr2R 18593094..18593135 1..42 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 12:33:56 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 1..599 1..599 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:47 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 1..599 1..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:23:08 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:01 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 12:33:55 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 1..599 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:47 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 1..599 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:23:08 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 19..617 1..599 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:01 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
Obp58c-RA 19..617 1..599 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:07 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22705946..22706153 392..599 100 <- Minus
2R 22706214..22706562 43..391 100 <- Minus
2R 22706619..22706660 1..42 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:07 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22705946..22706153 392..599 100 <- Minus
2R 22706214..22706562 43..391 100 <- Minus
2R 22706619..22706660 1..42 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:07 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22705946..22706153 392..599 100 <- Minus
2R 22706214..22706562 43..391 100 <- Minus
2R 22706619..22706660 1..42 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:23:08 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18593451..18593658 392..599 100 <- Minus
arm_2R 18593719..18594067 43..391 100 <- Minus
arm_2R 18594124..18594165 1..42 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:20 Download gff for RT06593.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22707145..22707352 392..599 100 <- Minus
2R 22707413..22707761 43..391 100 <- Minus
2R 22707818..22707859 1..42 100   Minus

RT06593.pep Sequence

Translation from 0 to 599

> RT06593.pep
MKCTILLSFFSLIWFAGGIKIDCENTEAINEDHIHYCCKHPDGHNDLIEG
CARETNFTLPNQNEEALVDITADRAIRGTCFGKCVFSKLNLMKDNNLDMD
AVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQ
FCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQDSLATL*

RT06593.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11330-PA 199 GF11330-PA 1..199 1..199 867 78.4 Plus
Dana\GF13531-PA 201 GF13531-PA 19..201 18..199 545 50.8 Plus
Dana\GF12411-PA 197 GF12411-PA 22..193 15..192 145 21.1 Plus
Dana\GF19946-PA 196 GF19946-PA 9..191 3..194 141 21.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20098-PA 199 GG20098-PA 1..199 1..199 1013 94 Plus
Dere\GG22785-PA 203 GG22785-PA 7..203 5..199 569 50.8 Plus
Dere\GG22669-PA 199 GG22669-PA 12..195 6..192 156 23.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23550-PA 202 GH23550-PA 10..202 7..199 700 61.7 Plus
Dgri\GH22094-PA 202 GH22094-PA 10..202 7..199 697 61.7 Plus
Dgri\GH23666-PA 199 GH23666-PA 6..199 4..199 696 60.7 Plus
Dgri\GH25269-PA 199 GH25269-PA 7..199 7..199 696 61.1 Plus
Dgri\GH22095-PA 232 GH22095-PA 48..232 15..199 678 62.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Obp58c-PA 199 CG13524-PA 1..199 1..199 1089 100 Plus
Obp58b-PA 203 CG13518-PA 22..203 19..199 584 54.4 Plus
Obp47b-PA 199 CG13208-PA 22..195 17..192 168 24.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19231-PA 199 GI19231-PA 7..199 7..199 742 64.2 Plus
Dmoj\GI20314-PA 200 GI20314-PA 5..200 5..199 554 52 Plus
Dmoj\GI19873-PA 189 GI19873-PA 11..184 5..192 176 24.9 Plus
Dmoj\GI23726-PA 190 GI23726-PA 2..184 5..194 144 23.3 Plus
Dmoj\GI19915-PA 208 GI19915-PA 8..197 5..193 143 24.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10709-PA 199 GL10709-PA 1..199 1..199 878 80.4 Plus
Dper\GL11371-PA 204 GL11371-PA 10..204 7..199 531 49.2 Plus
Dper\GL17347-PA 190 GL17347-PA 24..186 18..192 183 25.8 Plus
Dper\GL22030-PA 151 GL22030-PA 35..145 80..194 137 24.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp58c-PA 199 GA12342-PA 1..199 1..199 862 78.9 Plus
Dpse\Obp58b-PA 204 GA12339-PA 7..204 4..199 542 49.5 Plus
Dpse\Obp47b-PA 190 GA12122-PA 24..186 18..192 182 24.7 Plus
Dpse\Obp93a-PA 197 GA14440-PA 70..191 69..194 143 23.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15613-PA 199 GM15613-PA 1..199 1..199 1047 98 Plus
Dsec\GM15942-PA 193 GM15942-PA 21..192 18..188 431 44.8 Plus
Dsec\GM20448-PA 199 GM20448-PA 1..195 1..192 162 23.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp58b-PA 203 GD11695-PA 21..203 18..199 553 51.9 Plus
Dsim\Obp58c-PA 88 GD25107-PA 1..87 1..87 464 97.7 Plus
Dsim\Obp47b-PA 199 GD25916-PA 1..195 1..192 155 22.7 Plus
Dsim\Obp93a-PA 196 GD20005-PA 61..189 61..194 139 23 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp58c-PA 199 GJ20306-PA 1..199 1..199 772 67.3 Plus
Dvir\Obp58b-PA 219 GJ22040-PA 37..219 18..199 572 55.7 Plus
Dvir\Obp47b-PA 190 GJ15043-PA 20..186 15..192 177 24.6 Plus
Dvir\Obp49a-PA 212 GJ15082-PA 88..202 80..193 153 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21845-PA 202 GK21845-PA 1..202 1..199 675 61.9 Plus
Dwil\GK21448-PA 205 GK21448-PA 7..205 5..199 514 49.2 Plus
Dwil\GK22107-PA 184 GK22107-PA 21..180 17..192 155 22.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11839-PA 199 GE11839-PA 1..199 1..199 984 90.5 Plus
Dyak\GE14015-PA 203 GE14015-PA 21..203 18..199 573 54.6 Plus
Dyak\GE13025-PA 198 GE13025-PA 1..194 1..192 163 23.6 Plus

RT06593.hyp Sequence

Translation from 1 to 597

> RT06593.hyp
MKCTILLSFFSLIWFAGGIKIDCENTEAINEDHIHYCCKHPDGHNDLIEG
CARETNFTLPNQNEEALVDITADRAIRGTCFGKCVFSKLNLMKDNNLDMD
AVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQ
FCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQDSLATL

RT06593.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Obp58c-PA 199 CG13524-PA 1..199 1..199 1089 100 Plus
Obp58b-PA 203 CG13518-PA 22..203 19..199 584 54.4 Plus
Obp47b-PA 199 CG13208-PA 22..195 17..192 168 24.2 Plus