Clone Sequence Records
RT06796.complete Sequence
732 bp assembled on 2011-07-27
GenBank Submission: BT122075.2
> RT06796.complete
ATGCCATCGCCCAAGAAAAGAAGTGTGGATAAAGCGGATGGCAAGAAGGG
CAAGGGTCAAGGAGCAGGCGGCGTGAAGGGATGCTGCTGCAAGCGGTCGC
AGTGCATCAAGAACTACTGCGACTGCTATCAGTCCATGGCCATCTGCACC
AAGTTCTGTCGATGCGTTGGCTGCAGGAACACAGAGGTGCGCGAGTTGGT
GGACCCCAACTCCGTGGCCAAGAATTCCAGCGCTGTGAAAAGGCAGAAGG
CGGCTGCGATGAGCGCCAAGGCAGCAGCCGCAGCTGCCAAGGCGGGCATC
GATGTCCAGGGCAAGGCGCTCCAGGTGGCGGCATCCACTTTGGCGTTGCC
CGGCAAGGCGCTAATGACGCCGCCAAAGTATACCCTAGTGGCTGGCAAAC
CACCGATGGCTAGTAGTCACATTAACCCCATACCCATCTCACGACCCATA
GCGACTGCCGCCACTCCAGCCAGGGCGGTGAAGCAACCGGCGGAACCTCC
GATGCCCGTCAATCTGATCATTCCGGTGCGGCACGACGATCGCAGGGATC
GGAATCTCTTCGTGCAGCCGGTGAACGCGGCTCTGCTGGAGTGCATGCTC
ATCCAGGCCACGGAAGCCGAACAGTTGGGCCTGAACGAGCTCCAAGTGTG
CCAGCTGGTGCTCGAAGAGTTTATGCGCGGCTACAAGAACATTTTGGAGA
AAATATGCGAGTACAGCAAGGATTATTATTAA
RT06796.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:36:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
tomb-RA | 732 | tomb-RA | 1..729 | 1..729 | 3630 | 99.8 | Plus |
Cap-D3-RA | 5208 | Cap-D3-RA | 4036..4596 | 729..169 | 2790 | 99.8 | Minus |
Cap-D3-RA | 5208 | Cap-D3-RA | 4657..4826 | 170..1 | 850 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 5535033..5535594 | 730..169 | 2795 | 99.8 | Minus |
chr2L | 23010047 | chr2L | 5535655..5535824 | 170..1 | 850 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5535933..5536496 | 732..169 | 2805 | 99.8 | Minus |
2L | 23513712 | 2L | 5536557..5536726 | 170..1 | 850 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5535933..5536496 | 732..169 | 2805 | 99.8 | Minus |
2L | 23513712 | 2L | 5536557..5536726 | 170..1 | 850 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 10:50:56 has no hits.
RT06796.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:50 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 5535031..5535593 | 170..732 | 99 | <- | Minus |
chr2L | 5535656..5535824 | 1..169 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-19 15:46:37 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 1..729 | 1..729 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:33 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 1..732 | 1..732 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:48 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 1..732 | 1..732 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:35 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 1..732 | 1..732 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 15:46:37 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 1..729 | 1..729 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:33 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 1..732 | 1..732 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:48 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 33..764 | 1..732 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:35 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
tomb-RA | 33..764 | 1..732 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:50 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5535933..5536495 | 170..732 | 99 | <- | Minus |
2L | 5536558..5536726 | 1..169 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:50 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5535933..5536495 | 170..732 | 99 | <- | Minus |
2L | 5536558..5536726 | 1..169 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:50 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5535933..5536495 | 170..732 | 99 | <- | Minus |
2L | 5536558..5536726 | 1..169 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:48 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5535933..5536495 | 170..732 | 99 | <- | Minus |
arm_2L | 5536558..5536726 | 1..169 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:41 Download gff for
RT06796.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5535933..5536495 | 170..732 | 99 | <- | Minus |
2L | 5536558..5536726 | 1..169 | 100 | | Minus |
RT06796.pep Sequence
Translation from 0 to 731
> RT06796.pep
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY*
RT06796.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:15:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14749-PA | 324 | GF14749-PA | 102..321 | 25..239 | 492 | 54.5 | Plus |
Dana\GF13699-PA | 921 | GF13699-PA | 781..827 | 26..72 | 168 | 59.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:15:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24300-PA | 239 | GG24300-PA | 1..239 | 1..243 | 868 | 77 | Plus |
Dere\GG20386-PA | 944 | GG20386-PA | 806..852 | 26..72 | 167 | 59.6 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:15:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH11450-PA | 225 | GH11450-PA | 4..215 | 6..231 | 288 | 41.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
tomb-PA | 243 | CG14016-PA | 1..243 | 1..243 | 1267 | 100 | Plus |
mip120-PA | 950 | CG6061-PA | 812..858 | 26..72 | 167 | 57.4 | Plus |
mip120-PB | 952 | CG6061-PB | 814..860 | 26..72 | 167 | 57.4 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:15:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI21907-PA | 234 | GI21907-PA | 25..230 | 26..233 | 337 | 45.4 | Plus |
Dmoj\GI21332-PA | 879 | GI21332-PA | 738..784 | 26..72 | 162 | 57.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:15:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25902-PA | 296 | GL25902-PA | 15..291 | 3..236 | 337 | 34.6 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:15:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12700-PA | 296 | GA12700-PA | 15..291 | 3..236 | 349 | 35.1 | Plus |
Dpse\GA19331-PA | 978 | GA19331-PA | 839..885 | 26..72 | 163 | 57.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:15:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18017-PA | 240 | GM18017-PA | 1..239 | 1..242 | 1017 | 86.4 | Plus |
Dsec\GM21473-PA | 949 | GM21473-PA | 811..857 | 26..72 | 166 | 59.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:15:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10970-PA | 950 | GD10970-PA | 812..858 | 26..72 | 167 | 59.6 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:15:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17819-PA | 225 | GJ17819-PA | 25..221 | 26..233 | 349 | 47 | Plus |
Dvir\GJ19678-PA | 980 | GJ19678-PA | 840..886 | 26..72 | 161 | 57.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:15:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14905-PA | 250 | GK14905-PA | 23..248 | 25..236 | 293 | 36.9 | Plus |
Dwil\GK15963-PA | 587 | GK15963-PA | 439..485 | 26..72 | 159 | 57.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:15:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18995-PA | 237 | GE18995-PA | 1..237 | 1..243 | 867 | 77.8 | Plus |
Dyak\GE12548-PA | 950 | GE12548-PA | 812..858 | 26..72 | 167 | 59.6 | Plus |
RT06796.hyp Sequence
Translation from 1 to 729
> RT06796.hyp
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY
RT06796.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
tomb-PA | 243 | CG14016-PA | 1..243 | 1..243 | 1267 | 100 | Plus |
mip120-PA | 950 | CG6061-PA | 812..858 | 26..72 | 167 | 57.4 | Plus |
mip120-PB | 952 | CG6061-PB | 814..860 | 26..72 | 167 | 57.4 | Plus |
RT06796.hyp2 Sequence
Translation from 1 to 730
> RT06796.hyp2
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY*
RT06796.hyp2 Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
tomb-PA | 243 | CG14016-PA | 1..243 | 1..243 | 1267 | 100 | Plus |
mip120-PA | 950 | CG6061-PA | 812..858 | 26..72 | 167 | 57.4 | Plus |
mip120-PB | 952 | CG6061-PB | 814..860 | 26..72 | 167 | 57.4 | Plus |
RT06796.hyp3 Sequence
Translation from 1 to 731
> RT06796.hyp3
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY*
RT06796.hyp3 Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
tomb-PA | 243 | CG14016-PA | 1..243 | 1..243 | 1267 | 100 | Plus |
mip120-PA | 950 | CG6061-PA | 812..858 | 26..72 | 167 | 57.4 | Plus |
mip120-PB | 952 | CG6061-PB | 814..860 | 26..72 | 167 | 57.4 | Plus |