Clone RT06796 Report

Search the DGRC for RT06796

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:67
Well:96
Vector:pCR2.1
Associated Gene/Transcripttomb-RA
Protein status:RT06796.pep: gold
Sequenced Size:732

Clone Sequence Records

RT06796.complete Sequence

732 bp assembled on 2011-07-27

GenBank Submission: BT122075.2

> RT06796.complete
ATGCCATCGCCCAAGAAAAGAAGTGTGGATAAAGCGGATGGCAAGAAGGG
CAAGGGTCAAGGAGCAGGCGGCGTGAAGGGATGCTGCTGCAAGCGGTCGC
AGTGCATCAAGAACTACTGCGACTGCTATCAGTCCATGGCCATCTGCACC
AAGTTCTGTCGATGCGTTGGCTGCAGGAACACAGAGGTGCGCGAGTTGGT
GGACCCCAACTCCGTGGCCAAGAATTCCAGCGCTGTGAAAAGGCAGAAGG
CGGCTGCGATGAGCGCCAAGGCAGCAGCCGCAGCTGCCAAGGCGGGCATC
GATGTCCAGGGCAAGGCGCTCCAGGTGGCGGCATCCACTTTGGCGTTGCC
CGGCAAGGCGCTAATGACGCCGCCAAAGTATACCCTAGTGGCTGGCAAAC
CACCGATGGCTAGTAGTCACATTAACCCCATACCCATCTCACGACCCATA
GCGACTGCCGCCACTCCAGCCAGGGCGGTGAAGCAACCGGCGGAACCTCC
GATGCCCGTCAATCTGATCATTCCGGTGCGGCACGACGATCGCAGGGATC
GGAATCTCTTCGTGCAGCCGGTGAACGCGGCTCTGCTGGAGTGCATGCTC
ATCCAGGCCACGGAAGCCGAACAGTTGGGCCTGAACGAGCTCCAAGTGTG
CCAGCTGGTGCTCGAAGAGTTTATGCGCGGCTACAAGAACATTTTGGAGA
AAATATGCGAGTACAGCAAGGATTATTATTAA

RT06796.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
tomb-RA 732 tomb-RA 1..729 1..729 3630 99.8 Plus
Cap-D3-RA 5208 Cap-D3-RA 4036..4596 729..169 2790 99.8 Minus
Cap-D3-RA 5208 Cap-D3-RA 4657..4826 170..1 850 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5535033..5535594 730..169 2795 99.8 Minus
chr2L 23010047 chr2L 5535655..5535824 170..1 850 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5535933..5536496 732..169 2805 99.8 Minus
2L 23513712 2L 5536557..5536726 170..1 850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5535933..5536496 732..169 2805 99.8 Minus
2L 23513712 2L 5536557..5536726 170..1 850 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:50:56 has no hits.

RT06796.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:50 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5535031..5535593 170..732 99 <- Minus
chr2L 5535656..5535824 1..169 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-19 15:46:37 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 1..729 1..729 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:33 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:48 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:35 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 15:46:37 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 1..729 1..729 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:33 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 1..732 1..732 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:48 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 33..764 1..732 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:35 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
tomb-RA 33..764 1..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:50 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5535933..5536495 170..732 99 <- Minus
2L 5536558..5536726 1..169 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:50 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5535933..5536495 170..732 99 <- Minus
2L 5536558..5536726 1..169 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:50 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5535933..5536495 170..732 99 <- Minus
2L 5536558..5536726 1..169 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:48 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5535933..5536495 170..732 99 <- Minus
arm_2L 5536558..5536726 1..169 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:41 Download gff for RT06796.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5535933..5536495 170..732 99 <- Minus
2L 5536558..5536726 1..169 100   Minus

RT06796.pep Sequence

Translation from 0 to 731

> RT06796.pep
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY*

RT06796.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14749-PA 324 GF14749-PA 102..321 25..239 492 54.5 Plus
Dana\GF13699-PA 921 GF13699-PA 781..827 26..72 168 59.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24300-PA 239 GG24300-PA 1..239 1..243 868 77 Plus
Dere\GG20386-PA 944 GG20386-PA 806..852 26..72 167 59.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11450-PA 225 GH11450-PA 4..215 6..231 288 41.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
tomb-PA 243 CG14016-PA 1..243 1..243 1267 100 Plus
mip120-PA 950 CG6061-PA 812..858 26..72 167 57.4 Plus
mip120-PB 952 CG6061-PB 814..860 26..72 167 57.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21907-PA 234 GI21907-PA 25..230 26..233 337 45.4 Plus
Dmoj\GI21332-PA 879 GI21332-PA 738..784 26..72 162 57.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25902-PA 296 GL25902-PA 15..291 3..236 337 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12700-PA 296 GA12700-PA 15..291 3..236 349 35.1 Plus
Dpse\GA19331-PA 978 GA19331-PA 839..885 26..72 163 57.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18017-PA 240 GM18017-PA 1..239 1..242 1017 86.4 Plus
Dsec\GM21473-PA 949 GM21473-PA 811..857 26..72 166 59.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10970-PA 950 GD10970-PA 812..858 26..72 167 59.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17819-PA 225 GJ17819-PA 25..221 26..233 349 47 Plus
Dvir\GJ19678-PA 980 GJ19678-PA 840..886 26..72 161 57.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14905-PA 250 GK14905-PA 23..248 25..236 293 36.9 Plus
Dwil\GK15963-PA 587 GK15963-PA 439..485 26..72 159 57.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18995-PA 237 GE18995-PA 1..237 1..243 867 77.8 Plus
Dyak\GE12548-PA 950 GE12548-PA 812..858 26..72 167 59.6 Plus

RT06796.hyp Sequence

Translation from 1 to 729

> RT06796.hyp
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY

RT06796.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
tomb-PA 243 CG14016-PA 1..243 1..243 1267 100 Plus
mip120-PA 950 CG6061-PA 812..858 26..72 167 57.4 Plus
mip120-PB 952 CG6061-PB 814..860 26..72 167 57.4 Plus

RT06796.hyp2 Sequence

Translation from 1 to 730

> RT06796.hyp2
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY*

RT06796.hyp2 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
tomb-PA 243 CG14016-PA 1..243 1..243 1267 100 Plus
mip120-PA 950 CG6061-PA 812..858 26..72 167 57.4 Plus
mip120-PB 952 CG6061-PB 814..860 26..72 167 57.4 Plus

RT06796.hyp3 Sequence

Translation from 1 to 731

> RT06796.hyp3
MPSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICT
KFCRCVGCRNTEVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGI
DVQGKALQVAASTLALPGKALMTPPKYTLVAGKPPMASSHINPIPISRPI
ATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALLECML
IQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKDYY*

RT06796.hyp3 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
tomb-PA 243 CG14016-PA 1..243 1..243 1267 100 Plus
mip120-PA 950 CG6061-PA 812..858 26..72 167 57.4 Plus
mip120-PB 952 CG6061-PB 814..860 26..72 167 57.4 Plus