Clone RT06915 Report

Search the DGRC for RT06915

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:69
Well:15
Vector:pCR2.1
Associated Gene/TranscriptPburs-RA
Protein status:RT06915.pep: gold
Sequenced Size:426

Clone Sequence Records

RT06915.complete Sequence

426 bp assembled on 2010-03-23

GenBank Submission: BT122094.1

> RT06915.complete
ATGCATGTCCAGGAACTGCTCTTTGTGGCCGCGATCCTAGTGCCCCAATG
CCTGAGGGCATTGCGATATAGCCAAGGCACTGGCGACGAGAACTGCGAGA
CTCTCAAGTCGGAGATCCACTTGATCAAGGAGGAGTTCGACGAGCTGGGC
CGGATGCAGAGGACCTGCAATGCCGACGTCATCGTCAACAAATGCGAAGG
ATTGTGCAACAGTCAGGTGCAACCATCGGTGATAACGCCCACGGGGTTTC
TGAAAGAGTGCTACTGCTGCCGCGAAAGCTTCCTCAAGGAAAAGGTCATC
ACTCTAACCCATTGCTATGACCCGGACGGCACCCGTTTGACCTCTCCGGA
AATGGGAAGCATGGATATACGTCTTCGGGAGCCCACCGAGTGCAAGTGCT
TCAAATGTGGCGATTTCACACGTTAA

RT06915.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
pburs-RA 769 pburs-RA 145..570 1..426 2130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14415859..14416114 256..1 1280 100 Minus
chr2L 23010047 chr2L 14415633..14415801 424..256 845 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:43:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14417063..14417318 256..1 1280 100 Minus
2L 23513712 2L 14416835..14417005 426..256 855 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14417063..14417318 256..1 1280 100 Minus
2L 23513712 2L 14416835..14417005 426..256 855 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:03:34 has no hits.

RT06915.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:04:44 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14415631..14415801 256..426 100 <- Minus
chr2L 14415860..14416114 1..255 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-23 18:03:59 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
pburs-RA 1..424 1..424 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:09:06 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
pburs-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:50:59 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
pburs-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:10 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
Pburs-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-23 18:03:59 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
pburs-RA 1..424 1..424 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:09:06 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
pburs-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:50:59 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
pburs-RA 14..439 1..426 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:10 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
Pburs-RA 14..439 1..426 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:44 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14416835..14417005 256..426 100 <- Minus
2L 14417064..14417318 1..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:44 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14416835..14417005 256..426 100 <- Minus
2L 14417064..14417318 1..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:44 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14416835..14417005 256..426 100 <- Minus
2L 14417064..14417318 1..255 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:50:59 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14416835..14417005 256..426 100 <- Minus
arm_2L 14417064..14417318 1..255 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:34:00 Download gff for RT06915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14417064..14417318 1..255 100   Minus
2L 14416835..14417005 256..426 100 <- Minus

RT06915.pep Sequence

Translation from 0 to 425

> RT06915.pep
MHVQELLFVAAILVPQCLRALRYSQGTGDENCETLKSEIHLIKEEFDELG
RMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVI
TLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR*

RT06915.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15013-PA 141 GF15013-PA 1..141 1..141 734 97.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24257-PA 141 GG24257-PA 1..141 1..141 741 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13411-PA 141 GH13411-PA 1..141 1..141 669 92.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
Pburs-PA 141 CG15284-PA 1..141 1..141 765 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17649-PA 142 GI17649-PA 1..142 1..141 661 93 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13626-PA 142 GA13626-PA 1..142 1..141 706 94.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14817-PA 141 GM14817-PA 1..141 1..141 745 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22006-PA 141 GD22006-PA 1..141 1..141 745 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18214-PA 141 GJ18214-PA 1..141 1..141 701 92.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18089-PA 141 GK18089-PA 1..141 1..141 709 92.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25004-PA 141 GE25004-PA 1..141 1..141 741 99.3 Plus

RT06915.hyp Sequence

Translation from 1 to 423

> RT06915.hyp
MHVQELLFVAAILVPQCLRALRYSQGTGDENCETLKSEIHLIKEEFDELG
RMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVI
TLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR

RT06915.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Pburs-PA 141 CG15284-PA 1..141 1..141 765 100 Plus