Clone Sequence Records
RT06922.complete Sequence
633 bp assembled on 2011-07-27
GenBank Submission: BT122093.2
> RT06922.complete
ATGTTCAAGTCATCGATTTCAATCGTCGTTCTGCACCTGCTCCTGCTGGT
GTCCTTCGGAGGAGCTTACACCCTTCCGCCGGTGGTGCAGATGGGTGGTG
CAATCGTGGCAGCCGTGGAGCAGGACGCCGAGCAGGAAGCTGCCGCCGAG
GAGCGGCAGCGAGTCGAGCGTCATTGGCTATCGATGGCCGAAACGCAGTT
GCACAGCCTGATCACAGACGATTTGAGCACAGAGGAGGTAAACAATATGC
TGGAGACCTGGTCTACCGAAGGTCGCGGTAAGCACAAAAAGCAAAAAAAG
CTCATGAAAATGGTGTATCCGCTTCTGGCTGCCGTAGCCGTTGCCAAAGT
TGTTTTGCTACCCTTGATCCTGAAATGGCTTACGGCGCTTTCGACCTCGT
CGTTTGTCATGGGCAAAATCGCTTTGGTCACATCCGGTATTTTGGCTCTG
AAATGGATTTTGTCTGGAGGACATGCACACGATCGCCTGGAGATAATTCA
CTCTCATGCACCACTCGTTAAAGGATTACACGCCAGTGATTTATCCTCCA
GCGGAAGCAGTTGGATGCCCATTCGACAGCCCTTTATACCATTGGTCTCC
AAAGACCCTAACTTGTATAAGCCATTTTTATAG
RT06922.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:37:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Osi13.b | 1521 | Osi13.b | 166..797 | 1..632 | 3160 | 100 | Plus |
Osi13-RA | 922 | Osi13-RA | 166..797 | 1..632 | 3160 | 100 | Plus |
Osi13.a | 1235 | Osi13.a | 166..797 | 1..632 | 3160 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:51:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 2118076..2118439 | 270..633 | 1820 | 100 | Plus |
chr3R | 27901430 | chr3R | 2117572..2117844 | 1..273 | 1350 | 99.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:44:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 6292406..6292769 | 270..633 | 1820 | 100 | Plus |
3R | 32079331 | 3R | 6291902..6292174 | 1..273 | 1365 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 6033237..6033600 | 270..633 | 1820 | 100 | Plus |
3R | 31820162 | 3R | 6032733..6033005 | 1..273 | 1365 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 10:51:01 has no hits.
RT06922.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:53 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 2117572..2117842 | 1..271 | 99 | -> | Plus |
chr3R | 2118078..2118439 | 272..633 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-23 18:04:10 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 1..631 | 1..631 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:35 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 1..633 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:56 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 1..633 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:43 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 1..633 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-23 18:04:09 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 1..631 | 1..631 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:34 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 1..633 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:56 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 166..798 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:43 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Osi13-RA | 166..798 | 1..633 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:53 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6291902..6292172 | 1..271 | 100 | -> | Plus |
3R | 6292408..6292769 | 272..633 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:53 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6291902..6292172 | 1..271 | 100 | -> | Plus |
3R | 6292408..6292769 | 272..633 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:53 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6291902..6292172 | 1..271 | 100 | -> | Plus |
3R | 6292408..6292769 | 272..633 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:56 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2117624..2117894 | 1..271 | 100 | -> | Plus |
arm_3R | 2118130..2118491 | 272..633 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:50 Download gff for
RT06922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6032733..6033003 | 1..271 | 100 | -> | Plus |
3R | 6033239..6033600 | 272..633 | 100 | | Plus |
RT06922.pep Sequence
Translation from 0 to 632
> RT06922.pep
MFKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAE
ERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKK
LMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILAL
KWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIPLVS
KDPNLYKPFL*
RT06922.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:15:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF16385-PA | 214 | GF16385-PA | 1..214 | 1..210 | 734 | 71 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:15:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13203-PA | 213 | GG13203-PA | 1..213 | 1..210 | 852 | 88.3 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:15:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH14029-PA | 208 | GH14029-PA | 6..208 | 9..210 | 507 | 58.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Osi13-PA | 210 | CG15595-PA | 1..210 | 1..210 | 1058 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:15:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI24402-PA | 207 | GI24402-PA | 1..207 | 6..210 | 411 | 55.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:15:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24066-PA | 219 | GL24066-PA | 1..219 | 1..210 | 701 | 67.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:15:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13837-PA | 219 | GA13837-PA | 1..219 | 1..210 | 717 | 68.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:15:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM10874-PA | 210 | GM10874-PA | 1..210 | 1..210 | 1071 | 99 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:15:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19856-PA | 210 | GD19856-PA | 1..210 | 1..210 | 1071 | 99 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:15:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ14260-PA | 207 | GJ14260-PA | 13..207 | 16..210 | 386 | 60.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:15:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13043-PA | 222 | GK13043-PA | 13..222 | 16..210 | 522 | 60.7 | Plus |
Dwil\GK18804-PA | 220 | GK18804-PA | 13..220 | 16..210 | 493 | 59.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:15:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10197-PA | 213 | GE10197-PA | 1..213 | 1..210 | 785 | 87.3 | Plus |
RT06922.hyp Sequence
Translation from 1 to 630
> RT06922.hyp
MFKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAE
ERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKK
LMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILAL
KWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIPLVS
KDPNLYKPFL
RT06922.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Osi13-PA | 210 | CG15595-PA | 1..210 | 1..210 | 1058 | 100 | Plus |
RT06922.hyp2 Sequence
Translation from 1 to 632
> RT06922.hyp2
MFKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAE
ERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKK
LMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILAL
KWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIPLVS
KDPNLYKPFL*
RT06922.hyp2 Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Osi13-PA | 210 | CG15595-PA | 1..210 | 1..210 | 1058 | 100 | Plus |