Clone RT06922 Report

Search the DGRC for RT06922

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:69
Well:22
Vector:pCR2.1
Associated Gene/TranscriptOsi13-RA
Protein status:RT06922.pep: gold
Sequenced Size:633

Clone Sequence Records

RT06922.complete Sequence

633 bp assembled on 2011-07-27

GenBank Submission: BT122093.2

> RT06922.complete
ATGTTCAAGTCATCGATTTCAATCGTCGTTCTGCACCTGCTCCTGCTGGT
GTCCTTCGGAGGAGCTTACACCCTTCCGCCGGTGGTGCAGATGGGTGGTG
CAATCGTGGCAGCCGTGGAGCAGGACGCCGAGCAGGAAGCTGCCGCCGAG
GAGCGGCAGCGAGTCGAGCGTCATTGGCTATCGATGGCCGAAACGCAGTT
GCACAGCCTGATCACAGACGATTTGAGCACAGAGGAGGTAAACAATATGC
TGGAGACCTGGTCTACCGAAGGTCGCGGTAAGCACAAAAAGCAAAAAAAG
CTCATGAAAATGGTGTATCCGCTTCTGGCTGCCGTAGCCGTTGCCAAAGT
TGTTTTGCTACCCTTGATCCTGAAATGGCTTACGGCGCTTTCGACCTCGT
CGTTTGTCATGGGCAAAATCGCTTTGGTCACATCCGGTATTTTGGCTCTG
AAATGGATTTTGTCTGGAGGACATGCACACGATCGCCTGGAGATAATTCA
CTCTCATGCACCACTCGTTAAAGGATTACACGCCAGTGATTTATCCTCCA
GCGGAAGCAGTTGGATGCCCATTCGACAGCCCTTTATACCATTGGTCTCC
AAAGACCCTAACTTGTATAAGCCATTTTTATAG

RT06922.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Osi13.b 1521 Osi13.b 166..797 1..632 3160 100 Plus
Osi13-RA 922 Osi13-RA 166..797 1..632 3160 100 Plus
Osi13.a 1235 Osi13.a 166..797 1..632 3160 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2118076..2118439 270..633 1820 100 Plus
chr3R 27901430 chr3R 2117572..2117844 1..273 1350 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:44:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6292406..6292769 270..633 1820 100 Plus
3R 32079331 3R 6291902..6292174 1..273 1365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6033237..6033600 270..633 1820 100 Plus
3R 31820162 3R 6032733..6033005 1..273 1365 100 Plus
Blast to na_te.dros performed on 2019-03-15 10:51:01 has no hits.

RT06922.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:53 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2117572..2117842 1..271 99 -> Plus
chr3R 2118078..2118439 272..633 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-23 18:04:10 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 1..631 1..631 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:35 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 1..633 1..633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:56 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 1..633 1..633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:43 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-23 18:04:09 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 1..631 1..631 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:34 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:56 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 166..798 1..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:43 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
Osi13-RA 166..798 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:53 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6291902..6292172 1..271 100 -> Plus
3R 6292408..6292769 272..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:53 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6291902..6292172 1..271 100 -> Plus
3R 6292408..6292769 272..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:53 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6291902..6292172 1..271 100 -> Plus
3R 6292408..6292769 272..633 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:56 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2117624..2117894 1..271 100 -> Plus
arm_3R 2118130..2118491 272..633 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:50 Download gff for RT06922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6032733..6033003 1..271 100 -> Plus
3R 6033239..6033600 272..633 100   Plus

RT06922.pep Sequence

Translation from 0 to 632

> RT06922.pep
MFKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAE
ERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKK
LMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILAL
KWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIPLVS
KDPNLYKPFL*

RT06922.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16385-PA 214 GF16385-PA 1..214 1..210 734 71 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13203-PA 213 GG13203-PA 1..213 1..210 852 88.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14029-PA 208 GH14029-PA 6..208 9..210 507 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
Osi13-PA 210 CG15595-PA 1..210 1..210 1058 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24402-PA 207 GI24402-PA 1..207 6..210 411 55.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24066-PA 219 GL24066-PA 1..219 1..210 701 67.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13837-PA 219 GA13837-PA 1..219 1..210 717 68.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10874-PA 210 GM10874-PA 1..210 1..210 1071 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19856-PA 210 GD19856-PA 1..210 1..210 1071 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14260-PA 207 GJ14260-PA 13..207 16..210 386 60.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13043-PA 222 GK13043-PA 13..222 16..210 522 60.7 Plus
Dwil\GK18804-PA 220 GK18804-PA 13..220 16..210 493 59.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10197-PA 213 GE10197-PA 1..213 1..210 785 87.3 Plus

RT06922.hyp Sequence

Translation from 1 to 630

> RT06922.hyp
MFKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAE
ERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKK
LMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILAL
KWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIPLVS
KDPNLYKPFL

RT06922.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Osi13-PA 210 CG15595-PA 1..210 1..210 1058 100 Plus

RT06922.hyp2 Sequence

Translation from 1 to 632

> RT06922.hyp2
MFKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAE
ERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKK
LMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILAL
KWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIPLVS
KDPNLYKPFL*

RT06922.hyp2 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Osi13-PA 210 CG15595-PA 1..210 1..210 1058 100 Plus