Clone RT06928 Report

Search the DGRC for RT06928

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:69
Well:28
Vector:pCR2.1
Associated Gene/TranscriptTotF-RA
Protein status:RT06928.pep: gold
Sequenced Size:378

Clone Sequence Records

RT06928.complete Sequence

378 bp assembled on 2011-07-27

GenBank Submission: BT122095.2

> RT06928.complete
ATGAAGACAGTCATTCTATTTGGCTTCCTGCTGGCACTTCTTGGATATTT
GGAAGCAGAACATGCACAGAGTGATCCTGAATTCACGGCCAAGGCACGTC
AAATGCTCGCAGTCTTCGGCAACTCAGAGGTCGATAGATACACCAAGTCC
CGAAATTTGCCCGCATTGATTGAGTTCTACGAGAAGTACTCCAGTCGTCT
GCCACTGACTGTCCAGGATCGGACCTATGCCAACAATGTGATCAGGAGGT
ACCGGGCACACAACAACCAACAGGTCGATGGTGTTCCTGCTCAGGGCGGA
GTTGGTGTGGTGTTCGCGCTACTTCTTCCTTTCGCTGTGTCAATTGTGGA
AGGAATCGCCAAGGCGATCAGAGAATAG

RT06928.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
TotF-RA 558 TotF-RA 101..477 1..377 1885 100 Plus
TotF.a 1560 TotF.a 101..477 1..377 1885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19910232..19910587 378..23 1690 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:44:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19911898..19912253 378..23 1780 100 Minus
2L 23513712 2L 19913215..19913342 197..70 190 76.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19911898..19912253 378..23 1780 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:51:04 has no hits.

RT06928.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:54 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19910644..19910666 1..23 100   Minus
chr2L 19910232..19910586 24..378 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-23 18:03:58 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 1..376 1..376 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:35 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 1..378 1..378 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:59 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 1..378 1..378 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:46 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 1..378 1..378 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-23 18:03:58 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 46..421 1..376 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:35 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 46..423 1..378 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:59 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 46..423 1..378 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:46 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
TotF-RA 46..423 1..378 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:54 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19911898..19912252 24..378 100 <- Minus
2L 19912310..19912332 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:54 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19911898..19912252 24..378 100 <- Minus
2L 19912310..19912332 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:54 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19911898..19912252 24..378 100 <- Minus
2L 19912310..19912332 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:59 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19911898..19912252 24..378 100 <- Minus
arm_2L 19912310..19912332 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:51 Download gff for RT06928.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19911898..19912252 24..378 100 <- Minus
2L 19912310..19912332 1..23 100   Minus

RT06928.pep Sequence

Translation from 0 to 377

> RT06928.pep
MKTVILFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKS
RNLPALIEFYEKYSSRLPLTVQDRTYANNVIRRYRAHNNQQVDGVPAQGG
VGVVFALLLPFAVSIVEGIAKAIRE*

RT06928.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21584-PA 130 GG21584-PA 22..101 21..100 272 60 Plus
Dere\GG25068-PA 131 GG25068-PA 9..129 5..123 183 38.7 Plus
Dere\GG16504-PA 152 GG16504-PA 29..111 28..109 145 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
TotF-PA 125 CG31691-PA 1..125 1..125 626 100 Plus
Victoria-PA 134 CG33117-PA 16..116 1..100 284 57.4 Plus
TotM-PB 131 CG14027-PB 10..129 6..123 190 39 Plus
TotM-PA 131 CG14027-PA 10..129 6..123 190 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24287-PA 230 GL24287-PA 117..202 22..106 178 39.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16081-PA 137 GA16081-PA 10..109 5..106 188 36.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16981-PA 117 GM16981-PA 1..117 1..117 533 85.5 Plus
Dsec\GM16980-PA 134 GM16980-PA 37..116 21..100 294 66.2 Plus
Dsec\GM15120-PA 150 GM15120-PA 8..111 5..109 139 33 Plus
Dsec\GM23148-PA 150 GM23148-PA 8..111 5..109 139 33 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21729-PA 125 GD21729-PA 1..125 1..125 596 89.6 Plus
Dsim\GD21728-PA 119 GD21728-PA 22..101 21..100 285 63.7 Plus
Dsim\GD23335-PA 131 GD23335-PA 9..129 5..123 205 40.3 Plus
Dsim\GD20023-PA 150 GD20023-PA 8..111 5..109 139 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12622-PA 128 GE12622-PA 22..101 21..100 286 65 Plus
Dyak\GE12623-PA 134 GE12623-PA 37..117 21..101 282 63 Plus
Dyak\GE25388-PA 131 GE25388-PA 4..129 3..123 193 38.1 Plus
Dyak\GE11142-PA 150 GE11142-PA 6..111 3..109 150 35.2 Plus

RT06928.hyp Sequence

Translation from 1 to 375

> RT06928.hyp
MKTVILFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKS
RNLPALIEFYEKYSSRLPLTVQDRTYANNVIRRYRAHNNQQVDGVPAQGG
VGVVFALLLPFAVSIVEGIAKAIRE

RT06928.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
TotF-PA 125 CG31691-PA 1..125 1..125 626 100 Plus
Victoria-PA 134 CG33117-PA 16..116 1..100 284 57.4 Plus
TotM-PB 131 CG14027-PB 10..129 6..123 190 39 Plus
TotM-PA 131 CG14027-PA 10..129 6..123 190 39 Plus

RT06928.hyp2 Sequence

Translation from 1 to 377

> RT06928.hyp2
MKTVILFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKS
RNLPALIEFYEKYSSRLPLTVQDRTYANNVIRRYRAHNNQQVDGVPAQGG
VGVVFALLLPFAVSIVEGIAKAIRE*

RT06928.hyp2 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
TotF-PA 125 CG31691-PA 1..125 1..125 626 100 Plus
Victoria-PA 134 CG33117-PA 16..116 1..100 284 57.4 Plus
TotM-PB 131 CG14027-PB 10..129 6..123 190 39 Plus
TotM-PA 131 CG14027-PA 10..129 6..123 190 39 Plus