Clone Sequence Records
RT06928.complete Sequence
378 bp assembled on 2011-07-27
GenBank Submission: BT122095.2
> RT06928.complete
ATGAAGACAGTCATTCTATTTGGCTTCCTGCTGGCACTTCTTGGATATTT
GGAAGCAGAACATGCACAGAGTGATCCTGAATTCACGGCCAAGGCACGTC
AAATGCTCGCAGTCTTCGGCAACTCAGAGGTCGATAGATACACCAAGTCC
CGAAATTTGCCCGCATTGATTGAGTTCTACGAGAAGTACTCCAGTCGTCT
GCCACTGACTGTCCAGGATCGGACCTATGCCAACAATGTGATCAGGAGGT
ACCGGGCACACAACAACCAACAGGTCGATGGTGTTCCTGCTCAGGGCGGA
GTTGGTGTGGTGTTCGCGCTACTTCTTCCTTTCGCTGTGTCAATTGTGGA
AGGAATCGCCAAGGCGATCAGAGAATAG
RT06928.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:37:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotF-RA | 558 | TotF-RA | 101..477 | 1..377 | 1885 | 100 | Plus |
TotF.a | 1560 | TotF.a | 101..477 | 1..377 | 1885 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:51:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 19910232..19910587 | 378..23 | 1690 | 98.3 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:44:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19911898..19912253 | 378..23 | 1780 | 100 | Minus |
2L | 23513712 | 2L | 19913215..19913342 | 197..70 | 190 | 76.6 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19911898..19912253 | 378..23 | 1780 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 10:51:04 has no hits.
RT06928.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:54 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 19910644..19910666 | 1..23 | 100 | | Minus |
chr2L | 19910232..19910586 | 24..378 | 98 | <- | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-23 18:03:58 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 1..376 | 1..376 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:35 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 1..378 | 1..378 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:59 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 1..378 | 1..378 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:46 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 1..378 | 1..378 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-23 18:03:58 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 46..421 | 1..376 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:35 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 46..423 | 1..378 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:59 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 46..423 | 1..378 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:46 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotF-RA | 46..423 | 1..378 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:54 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19911898..19912252 | 24..378 | 100 | <- | Minus |
2L | 19912310..19912332 | 1..23 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:54 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19911898..19912252 | 24..378 | 100 | <- | Minus |
2L | 19912310..19912332 | 1..23 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:54 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19911898..19912252 | 24..378 | 100 | <- | Minus |
2L | 19912310..19912332 | 1..23 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:59 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19911898..19912252 | 24..378 | 100 | <- | Minus |
arm_2L | 19912310..19912332 | 1..23 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:51 Download gff for
RT06928.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19911898..19912252 | 24..378 | 100 | <- | Minus |
2L | 19912310..19912332 | 1..23 | 100 | | Minus |
RT06928.pep Sequence
Translation from 0 to 377
> RT06928.pep
MKTVILFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKS
RNLPALIEFYEKYSSRLPLTVQDRTYANNVIRRYRAHNNQQVDGVPAQGG
VGVVFALLLPFAVSIVEGIAKAIRE*
RT06928.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:15:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21584-PA | 130 | GG21584-PA | 22..101 | 21..100 | 272 | 60 | Plus |
Dere\GG25068-PA | 131 | GG25068-PA | 9..129 | 5..123 | 183 | 38.7 | Plus |
Dere\GG16504-PA | 152 | GG16504-PA | 29..111 | 28..109 | 145 | 37.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotF-PA | 125 | CG31691-PA | 1..125 | 1..125 | 626 | 100 | Plus |
Victoria-PA | 134 | CG33117-PA | 16..116 | 1..100 | 284 | 57.4 | Plus |
TotM-PB | 131 | CG14027-PB | 10..129 | 6..123 | 190 | 39 | Plus |
TotM-PA | 131 | CG14027-PA | 10..129 | 6..123 | 190 | 39 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:15:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24287-PA | 230 | GL24287-PA | 117..202 | 22..106 | 178 | 39.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:15:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16081-PA | 137 | GA16081-PA | 10..109 | 5..106 | 188 | 36.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:15:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16981-PA | 117 | GM16981-PA | 1..117 | 1..117 | 533 | 85.5 | Plus |
Dsec\GM16980-PA | 134 | GM16980-PA | 37..116 | 21..100 | 294 | 66.2 | Plus |
Dsec\GM15120-PA | 150 | GM15120-PA | 8..111 | 5..109 | 139 | 33 | Plus |
Dsec\GM23148-PA | 150 | GM23148-PA | 8..111 | 5..109 | 139 | 33 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:15:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21729-PA | 125 | GD21729-PA | 1..125 | 1..125 | 596 | 89.6 | Plus |
Dsim\GD21728-PA | 119 | GD21728-PA | 22..101 | 21..100 | 285 | 63.7 | Plus |
Dsim\GD23335-PA | 131 | GD23335-PA | 9..129 | 5..123 | 205 | 40.3 | Plus |
Dsim\GD20023-PA | 150 | GD20023-PA | 8..111 | 5..109 | 139 | 33 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:15:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12622-PA | 128 | GE12622-PA | 22..101 | 21..100 | 286 | 65 | Plus |
Dyak\GE12623-PA | 134 | GE12623-PA | 37..117 | 21..101 | 282 | 63 | Plus |
Dyak\GE25388-PA | 131 | GE25388-PA | 4..129 | 3..123 | 193 | 38.1 | Plus |
Dyak\GE11142-PA | 150 | GE11142-PA | 6..111 | 3..109 | 150 | 35.2 | Plus |
RT06928.hyp Sequence
Translation from 1 to 375
> RT06928.hyp
MKTVILFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKS
RNLPALIEFYEKYSSRLPLTVQDRTYANNVIRRYRAHNNQQVDGVPAQGG
VGVVFALLLPFAVSIVEGIAKAIRE
RT06928.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotF-PA | 125 | CG31691-PA | 1..125 | 1..125 | 626 | 100 | Plus |
Victoria-PA | 134 | CG33117-PA | 16..116 | 1..100 | 284 | 57.4 | Plus |
TotM-PB | 131 | CG14027-PB | 10..129 | 6..123 | 190 | 39 | Plus |
TotM-PA | 131 | CG14027-PA | 10..129 | 6..123 | 190 | 39 | Plus |
RT06928.hyp2 Sequence
Translation from 1 to 377
> RT06928.hyp2
MKTVILFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKS
RNLPALIEFYEKYSSRLPLTVQDRTYANNVIRRYRAHNNQQVDGVPAQGG
VGVVFALLLPFAVSIVEGIAKAIRE*
RT06928.hyp2 Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotF-PA | 125 | CG31691-PA | 1..125 | 1..125 | 626 | 100 | Plus |
Victoria-PA | 134 | CG33117-PA | 16..116 | 1..100 | 284 | 57.4 | Plus |
TotM-PB | 131 | CG14027-PB | 10..129 | 6..123 | 190 | 39 | Plus |
TotM-PA | 131 | CG14027-PA | 10..129 | 6..123 | 190 | 39 | Plus |